DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cd and AT5G24450

DIOPT Version :8

Sequence 1:NP_609947.1 Gene:l(2)37Cd / 35193 FlyBaseID:FBgn0086445 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_197833.2 Gene:AT5G24450 / 832516 AraportID:AT5G24450 Length:554 Species:Arabidopsis thaliana

Alignment Length:558 Identity:129/559 (23%)
Similarity:217/559 (39%) Gaps:140/559 (25%)


  Fly     9 PQKEYELIEYPGRVVNPDRMIATLGGIINVSKVLGDEVKRLALHFHPENPYNKPTFGDCTDKTGV 73
            |.||..::.|||...:..|.:.|||||..::........:|.|||.||:|...|.:|:.....|.
plant    14 PSKEAFVVHYPGYPSSISRAVETLGGIQGITTARESTSNKLELHFRPEDPSAHPAYGERRHCNGF 78

  Fly    74 LLSITVRRHKKD---KQRP-------------PEYFVRVLGHCSRSFTFETLCDFQY-LPLWSTP 121
            ||.|:....|||   :.:|             |.....::...|.|:.|:.:.|:|: :|:    
plant    79 LLKISKEDVKKDSLPESQPVISTSDACLPEVRPALCADIVARVSESYCFDGMVDYQHVIPI---- 139

  Fly   122 KSDNANAAQELTYALDQLKPKN----TTDLDYFKRRHSQLLALPELFTHVDTVYAGTYRIDPSED 182
            .:|.|...:.....:..|..||    ..|.|.       ::.||:.|:             |.:.
plant   140 HADIAQQKKRKWMEVKSLAGKNDLMDMADEDV-------MMLLPQFFS-------------PKDR 184

  Fly   183 GQHEVLGVQSKSS---YDNQGVVSFNMVDSFPTQADSQNLKRL-KV----KYV---SDE---QLA 233
            ..:.||.:...||   .|.:...:...:|..|..|...::|.: |:    .|:   |::   |:|
plant   185 PDNLVLRLPVTSSPKKKDEELTQNLYEIDIGPVFAIDFSVKEIPKILKWEDYIVPTSNQWKWQVA 249

  Fly   234 LVKKLFDDCPIWTR---IALQYESGL--TNDKLKCITPSLAFYFSNGPWRTLYVRFGYDPRKDFN 293
             |..||::.|:|||   :....:.||  |:..|.......|:|||.||:...:::.|||||||..
plant   250 -VSALFEERPVWTRDSIVQRLLDKGLTCTHHMLNRFLLRAAYYFSGGPFLRFWIKRGYDPRKDPE 313

  Fly   294 SRYYQTFDFRLRFSTGLSEFVYAKKFVKQRRAANAPFAPIEDRVSDLVQDIDYPYFDE----HKL 354
            ||.:|..:||:  ...|..:..:....|.:                       |.:|:    ...
plant   314 SRVFQRMEFRV--PPELKGYCDSNATNKSK-----------------------PSWDDICAFKVF 353

  Fly   355 PRSRQCMLRYCDVRMTRIQEMLEKIPTPLTGAVCNERTGWL---------------------PPG 398
            |...|..|:..::....||:.:.|.|...|   ||.:|||.                     .||
plant   354 PFKCQTFLQLFELDDEYIQQEIRKPPKQTT---CNYKTGWFSEALLDNLRLRVAVRFVSVFPEPG 415

  Fly   399 FD------------AQVRQIVCASISELLRNHY-------RKENLTAEVEAVTQADE--EDEDEA 442
            |:            ::..:|...::....|||.       :.:|...|.:....|||  ||.|:.
plant   416 FEDVFKSIQEEFERSEKTRIQKDALQPSQRNHQETTKDMKKCKNTNKEKDDDVNADEDSEDLDDE 480

  Fly   443 EDEETQEEDMELDETQAMGNSEQFVDNDIEQLFDNITS 480
            .:|...::|:.: .:...|:.|......::.||:...|
plant   481 YEEAANDDDISI-SSHGYGDMENNSRTYLQGLFNRFPS 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)37CdNP_609947.1 Tau95 13..303 CDD:286777 86/330 (26%)
AT5G24450NP_197833.2 Tau95 19..323 CDD:286777 86/329 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I1901
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1111142at2759
OrthoInspector 1 1.000 T125111
orthoMCL 1 0.900 OOG5_128942
Panther 1 1.100 LDO PTHR13230
Phylome 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.