DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cd and AT3G49410

DIOPT Version :8

Sequence 1:NP_609947.1 Gene:l(2)37Cd / 35193 FlyBaseID:FBgn0086445 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001325756.1 Gene:AT3G49410 / 824103 AraportID:AT3G49410 Length:574 Species:Arabidopsis thaliana

Alignment Length:586 Identity:135/587 (23%)
Similarity:218/587 (37%) Gaps:186/587 (32%)


  Fly     9 PQKEYELIEYPGRVVNPDRMIATLGGIINVSKVLGDEVKRLALHFHPENPYNKPTFGDCTDKTGV 73
            |.||..::.:||...:..|.|.|||||..:::.......:|.|.|.||:||..|..|:....:|.
plant    14 PSKEAFVVHFPGYPSSISRAIETLGGIQGITQARESISNKLELRFRPEDPYAHPALGEQRPCSGF 78

  Fly    74 LLSITVRRHKKDKQRP------------------PEYFVRVLGHCSRSFTFETLCDFQY-LPLWS 119
            ||.|:    |:|.::|                  |.....::...|.||.|:.:.|:|: :|:  
plant    79 LLRIS----KQDIKKPESQSVLDTSRDVCLEEASPVLCADIVARLSESFHFDGMADYQHVIPI-- 137

  Fly   120 TPKSDNANAAQELTYALDQLKPKNTTDLDYFKRR--------HSQLLALPELFTHVDTVYAGTYR 176
                 :|:.||:        |.:...|:|....:        ...::.||:.|...|  ......
plant   138 -----HADIAQQ--------KKRKWMDVDPLTGKSDLMGLADEDVMMLLPQFFAPKD--IPDNVA 187

  Fly   177 IDPSEDGQHEVLGVQSKSSYDNQGVVSFNMVDSFPTQADSQNLKRLKVK-----YVSDE------ 230
            :.|....     |.:.|   |:....:|..:|..|..|...::|.:..|     :||..      
plant   188 LKPPATS-----GPKKK---DDAATQNFYEIDVGPVFAIDFSVKEIPKKLKWEDFVSRSSNHWQW 244

  Fly   231 QLALVKKLFDDCPIWTRIALQYESGLTNDKLKCITPSL-------AFYFSNGPWRTLYVRFGYDP 288
            |:| |..||::.|||||.::...  |.:..|||....|       |:|||:||:...:::.||||
plant   245 QVA-VSALFEERPIWTRDSVVQR--LLDKGLKCTHHMLNRFLLRAAYYFSSGPFLRFWIKRGYDP 306

  Fly   289 RKDFNSRYYQTFDFRLRFSTGLSEFVYAKKFVKQRRAANAPFAPIEDRVSDLVQDIDYPYFDEHK 353
            |.|..||.||..:||:                           |.|.|          .|.|.:.
plant   307 RNDPESRVYQRMEFRV---------------------------PPELR----------GYCDANA 334

  Fly   354 LPRSR----------------QCMLRYCDVRMTRIQEMLEKIPTPLTGAVCNERTGWL------- 395
            ...|:                |..|:..::....||..:.|.|...|   |:.::||.       
plant   335 TNNSKPSWNDICAFKLFPFKCQTFLQLFELDDEYIQREIRKPPKQTT---CSHKSGWFSEAMLDT 396

  Fly   396 --------------PPGFD------------AQVRQIVCASISELLRNHYRK----------ENL 424
                          ..||:            ::..||...::...|..|...          :::
plant   397 LRLRVAVRFVSVFPETGFEDVFKSIQEEFERSEKVQIQKETLKPSLVKHREATKGSEDMETFKSV 461

  Fly   425 TAEVEAVTQADEEDE---DEAEDEETQEE-DMELDETQAMGNSEQFVDND------IEQLFDNIT 479
            ...|:|....|.|||   ||.||||.:|| ||...:.:...:|..::|.:      ::.|||:..
plant   462 NENVDANVNEDGEDENLDDEDEDEEEEEELDMAAGDNEISLDSHGYLDTENSSRTYLQGLFDSFP 526

  Fly   480 S 480
            |
plant   527 S 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)37CdNP_609947.1 Tau95 13..303 CDD:286777 87/335 (26%)
AT3G49410NP_001325756.1 Tau95 19..321 CDD:286777 87/334 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I1901
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1111142at2759
OrthoInspector 1 1.000 T125111
orthoMCL 1 0.900 OOG5_128942
Panther 1 1.100 O PTHR13230
Phylome 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.