DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10561 and CG5653

Sequence 1:NP_476608.1 Gene:CG10561 FlyBaseID:FBgn0002036 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster

Alignment Length:509 Identity:146/510 (29%)
Similarity:238/510 (47%) Gaps:83/510 (16%)


  Fly    32 LEAARQNTQIVVVGAGLAGLSAAQHLLSHGFRRTVILEATDRYGGRINTQRFGDTYCELGAKWVK 96
            :|..|.:::|:::|||::|::||..||.:.|:...||||.||.||||||..|||...:|||:|..
  Fly     1 MEKCRASSRIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCH 65

  Fly    97 IDGSQDSMYELLRNTEGL---------------GKQIKQPDRATYLQD------GSRINPAM--- 137
             ...|:.:|:::::...|               .|::...:.|..:.|      .|..:|.:   
  Fly    66 -GKQQNCVYDMVKDMGILHETGDYYSPIKRVRSNKEVVPHELACRIHDIAVKSMPSGPHPVVGSF 129

  Fly   138 -VELIDTLFRQLCRGFKVSERVKTGGDLHSLDNVMNYFRTESDRIIGVSFQHPKDQLAAREIFQS 201
             ..|..|.:|::     .||..:...|:.|  ..:|.|......|||           |..:|:.
  Fly   130 GTHLTQTFWRKI-----ESELPQVNRDVAS--EALNTFAKHESSIIG-----------ADNLFEV 176

  Fly   202 LFKEFGSILGCCLEY--VNIEHITKCPVQQEQRPLYVPTGLDNVVDDLIQNMD--KAQLQTGKPV 262
            ..:|.       :||  .:.:.:.....:..:|.|.:   |..|..|..:.:.  :.::|....|
  Fly   177 SVREH-------IEYHECDGDKLLHWGTKGYRRFLRL---LMKVSADTPEELGLLEGRIQLDMKV 231

  Fly   263 GQIQWTPAPMKSV-GCLDGSLYNADHIICTLPLGVLKSFAGVLFRPTLPLDKMLAIRNLGFGNPL 326
            .:|: ...|.|.: .|.||..:.|||:|||:.||||:.....||.|.||..|:.|||:|..|...
  Fly   232 IKIE-LACPRKVILRCQDGDYFEADHVICTVSLGVLQEQHEKLFVPPLPAAKVNAIRSLTLGTVN 295

  Fly   327 KIYLSYKK---PIG------RWLKGSLRPLGTLLNPSVEQQPERNWTQQVVEISQVPSSQHVLEV 382
            |:||.|:|   |.|      .||:..|..|         ::.|..|.:.:..:..:.....:|..
  Fly   296 KLYLEYEKQPLPDGWVGFFCFWLEEDLIEL---------RKTEYFWVEGITGVHMITCQPRMLMA 351

  Fly   383 HVGGGYYEEIEKLPDEELLEQITGLLRRCVSSHLVPYPQELLRSNWSTSACYLGGRPYFSTNSSA 447
            .|.|.:...:|.|.||::||.:..|.|:.::.. :|.|:..:||:|.::..:.|...|....:..
  Fly   352 WVNGPHGRHMETLSDEKVLEGLYWLFRKFLTFE-IPPPKRFVRSSWFSNPNFRGSWSYRGVMADE 415

  Fly   448 RDV--QRLAAP-LGEKSP-GLLFAGDATSLRGFGTIDAARSSGIREAQRIIDYY 497
            |:.  ..|.:| |||... ||||||:|:|...|.|:..|..:|.|||.|:||:|
  Fly   416 RNTGPWDLESPVLGEDGHLGLLFAGEASSRNHFSTVHGAVEAGYREADRLIDHY 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10561NP_476608.1 NAD_binding_8 43..109 CDD:290186 30/66 (45%)
Amino_oxidase 48..494 CDD:279874 137/489 (28%)
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 30/67 (45%)
Amino_oxidase 17..466 CDD:279874 137/489 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117599296
eggNOG 1 0.900 E1_KOG0685
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375579at33208
OrthoFinder 1 1.000 FOG0000545
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10742
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.