DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and AIFM1

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_004199.1 Gene:AIFM1 HGNCID:8768 Length:613 Species:Homo sapiens

Alignment Length:564 Identity:127/565 (22%)
Similarity:213/565 (38%) Gaps:150/565 (27%)


  Fly    45 AVGAMCPHRGAPLAKGVL---SRNRVRCP------WHGVCFNLET-----------GDIEN---- 85
            |.||: ..:..||.:.|.   .|.|.|.|      || |...|:.           |.|:|    
Human     8 AAGAL-KQKLVPLVRTVCVRSPRQRNRLPGNLFQRWH-VPLELQMTRQMASSGASGGKIDNSVLV 70

  Fly    86 -FPGLDSLPCHRVNVDSRGQVLVQVKRSYLLRHARIKSMACRNWQDQRH---------------- 133
             ..||.:       |.:.......:|......:.||..:.....|.|:.                
Human    71 LIVGLST-------VGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKA 128

  Fly   134 -----FVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLL-----NTYTKNLAL 188
                 |:::|||.:......::|......|:.:|..:..|||.|..:...|     ...||.|..
Human   129 PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRF 193

  Fly   189 RE------------EQFY---------KDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYI 232
            ::            ..||         ::.|:.:..|....:||...|.:...:|....|:|..|
Human   194 KQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLI 258

  Fly   233 ATG-----YSAVTPNIPGVHLKN-VKVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVS 291
            |||     .||:  :..|..:|: ..:.|.|||.||:.|:..:...:..:|..|:..|....|..
Human   259 ATGGTPRSLSAI--DRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGR 321

  Fly   292 RARSVTLVARQNVPFKSTLGELIGQRILKLLEEN------KVDLRMSSGIIRILGNSRGEVVAVK 350
            :||::.....|..|.|..:|:::.:.:.....|.      ||   |.:.|::.:|.|.|::: :|
Human   322 KARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKV---MPNAIVQSVGVSSGKLL-IK 382

  Fly   351 LLDNSRIPCNLLILGTGCQCNTDFLQRSGININPN-GSVDVNDFLQTKVRNVYVGGDIANAY--I 412
            |.|..::..:.::...|.:.|.:..:..|:.|:.: |...||..||.: .|::|.||.|..|  .
Human   383 LKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQAR-SNIWVAGDAACFYDIK 446

  Fly   413 LGGFPDRVNISHYGLAQYHGRIAALNMSGHIAKLEAIPFFYTVIFGRAFRSAGYGPFKDV----- 472
            ||    |..:.|:..|...||:|..||:|     .|.|:::..:|.     :..||  ||     
Human   447 LG----RRRVEHHDHAVVSGRLAGENMTG-----AAKPYWHQSMFW-----SDLGP--DVGYEAI 495

  Fly   473 -VIDGSLEDLQFVAYFFDDYDKVTAVASCGRDPMVAQFAELVSQ 515
             ::|.||                         |.|..||:..:|
Human   496 GLVDSSL-------------------------PTVGVFAKATAQ 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 20/86 (23%)
Pyr_redox_2 135..414 CDD:285266 76/320 (24%)
Pyr_redox 273..350 CDD:278498 18/83 (22%)
COG3393 336..>508 CDD:225928 44/181 (24%)
Reductase_C 464..527 CDD:291425 12/59 (20%)
AIFM1NP_004199.1 AIF-MLS 52..>133 CDD:317386 11/88 (13%)
FAD-dependent oxidoreductase. {ECO:0000250} 134..483 90/365 (25%)
Pyr_redox_2 150..462 CDD:311792 77/323 (24%)
Nuclear localization signal. {ECO:0000255} 446..451 3/9 (33%)
AIF_C 465..593 CDD:317164 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.