DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and TRR2

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_011974.1 Gene:TRR2 SGDID:S000001148 Length:342 Species:Saccharomyces cerevisiae

Alignment Length:387 Identity:71/388 (18%)
Similarity:134/388 (35%) Gaps:135/388 (35%)


  Fly    80 TGDIENFPGL-DSLPCHRVNVDSRGQVLVQVKRSYLLRHARIKSMACRNWQDQRHFVVVGGGPSG 143
            |.|||||||. :||                                                 ||
Yeast    72 TTDIENFPGFPESL-------------------------------------------------SG 87

  Fly   144 AVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLALREEQFYKDYGIEMQLGVSAE 208
            :..:|.:|::.......::          |..::.::..:|...|..| |.:|          ||
Yeast    88 SELMERMRKQSAKFGTNII----------TETVSKVDLSSKPFRLWTE-FNED----------AE 131

  Fly   209 RLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGVHL---KNVKVIRNIGDARSIFKMVDKS 270
            .:.|               |.|.:|||.||...::||...   :.:........|..||:  :|.
Yeast   132 PVTT---------------DAIILATGASAKRMHLPGEETYWQQGISACAVCDGAVPIFR--NKP 179

  Fly   271 TQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQRILKLLEENKVDLRMSSGI 335
            ..|:..|.|  |.|....|...|..|.::.|:: .|::::  ::.:||     |...::.:....
Yeast   180 LAVIGGGDS--ACEEAEFLTKYASKVYILVRKD-HFRASV--IMQRRI-----EKNPNIIVLFNT 234

  Fly   336 IRILGNSRGEVVAVKLLDNSR------IPCNLLILGTGCQCNTDFLQRSGININPNGSVDVND-- 392
            :.:.....|:::.:..:.|::      :..|.|....|....||.::         |.||..:  
Yeast   235 VALEAKGDGKLLNMLRIKNTKSNVENDLEVNGLFYAIGHSPATDIVK---------GQVDEEETG 290

  Fly   393 FLQ-------TKVRNVYVGGDIANAYILGGFPDRVNISHYGLAQYHGRIAALNMSGHIAKLE 447
            :::       |.|...:..||:.::..      |..::..|    .|.||||:...:::..|
Yeast   291 YIKTVPGSSLTSVPGFFAAGDVQDSRY------RQAVTSAG----SGCIAALDAERYLSAQE 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 10/27 (37%)
Pyr_redox_2 135..414 CDD:285266 53/297 (18%)
Pyr_redox 273..350 CDD:278498 14/77 (18%)
COG3393 336..>508 CDD:225928 22/128 (17%)
Reductase_C 464..527 CDD:291425
TRR2NP_011974.1 TRX_reduct 28..338 CDD:273540 70/382 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80230226
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.