DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and AIF1

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_014472.1 Gene:AIF1 SGDID:S000005357 Length:378 Species:Saccharomyces cerevisiae

Alignment Length:329 Identity:68/330 (21%)
Similarity:129/330 (39%) Gaps:71/330 (22%)


  Fly   132 RHFVVVGGGPSG-AVCVETLRQEGFTGRLTLVCGEKHLPYDRTRI-MNLLNTYTKN-LALREEQF 193
            ::.||||.|..| :|.....|:.|.|..:.||....::.:..:.: :.:...|||: |.|:.   
Yeast     6 KNIVVVGAGVFGVSVANHLYRELGGTYAIKLVTASNYVYFLPSAVRLTVSKDYTKSILPLKN--- 67

  Fly   194 YKDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGVHLKNVKVIRNIG 258
            ..|.|||:....:|...|   ..:...:.:...:|.:.:|||.....|         :......|
Yeast    68 VLDSGIEVIKDTAASFDD---KEVVLGSDRAIKFDILVLATGSKWADP---------IGSTYTFG 120

  Fly   259 D-ARSIFK----MVDKSTQVVCLGSSFMAVEATANLV--------SRARSVTLVARQN--VPFKS 308
            | .:..|:    .:..:..::.||..|:..|....|:        |..:.::::...:  :|...
Yeast   121 DNYKEYFEREASRISDADHILFLGGGFVNCELAGELLFKYLEEIRSGKKRISIIHNSDKLLPDSG 185

  Fly   309 TLGELIGQRILKLLEENKVDLRMSSGIIRILGNSRGEVVAVKLLDNSRIPCNLLILGTGCQ--CN 371
            ...:.:.:.:...|.:|.:.|.:::     :|.|         ||.|.   ..:.||.|..  .:
Yeast   186 LYNDTLRKNVTDYLSKNGITLYLNT-----VGAS---------LDTSP---KRIFLGEGSSKYID 233

  Fly   372 TDFLQRSGININPNGSV-------DVNDFLQT----KVRNVYVGGDIANAYILGGFPDRVNISHY 425
            .|.:.| |:.|:||..|       |...|:|.    :|:.|..|    |.:.:|   |..|..::
Yeast   234 ADLIYR-GVGISPNVPVNSISDLCDKKGFIQVEKNFRVKAVEAG----NVFAIG---DVTNFRYH 290

  Fly   426 GLAQ 429
            ||.:
Yeast   291 GLVK 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 63/310 (20%)
Pyr_redox 273..350 CDD:278498 12/87 (14%)
COG3393 336..>508 CDD:225928 27/108 (25%)
Reductase_C 464..527 CDD:291425
AIF1NP_014472.1 NirB 21..>293 CDD:330997 61/312 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.