DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and AIFM2

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001185625.1 Gene:AIFM2 HGNCID:21411 Length:373 Species:Homo sapiens

Alignment Length:336 Identity:74/337 (22%)
Similarity:132/337 (39%) Gaps:68/337 (20%)


  Fly   133 HFVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNL-ALR---EEQF 193
            |.|:||||..|......|:             ..::|:   .::::.:::..|: |||   |..|
Human    13 HVVIVGGGFGGIAAASQLQ-------------ALNVPF---MLVDMKDSFHHNVAALRASVETGF 61

  Fly   194 YK----DYGIEMQ--------LGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGV 246
            .|    .|.:..:        :|:     |.....:....|:..|:..:.:|||   .|...||.
Human    62 AKKTFISYSVTFKDNFRQGLVVGI-----DLKNQMVLLQGGEALPFSHLILATG---STGPFPGK 118

  Fly   247 HLKNVKVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSR--ARSVTLVARQNVPFKST 309
            ..:.......|.....:.:.|.:|..:|.:|.....||..|.:.:.  .:.|||:..|.......
Human   119 FNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKE 183

  Fly   310 LGELIGQRILKLLEENKVDLRMS---SGIIRILGNSRGEVVAVKLLDNSRIPCNLLILGTGCQCN 371
            |...:.|.:.::|....|.|.:|   |.:..:..|...|.:.|:....:.:..||:||.||.:.|
Human   184 LLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKIN 248

  Fly   372 TDFLQRS-GININPNGSVDVNDFLQTKVR-NVYVGGDIAN------AYILGGFPDRVNISHYGLA 428
            :...::: ...:..:|::.||:.||.:.. |||..||.|:      ||:.|              
Human   249 SSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAG-------------- 299

  Fly   429 QYHGRIAALNM 439
             .|..||..|:
Human   300 -LHANIAVANI 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 68/308 (22%)
Pyr_redox 273..350 CDD:278498 19/82 (23%)
COG3393 336..>508 CDD:225928 28/113 (25%)
Reductase_C 464..527 CDD:291425
AIFM2NP_001185625.1 NirB 39..356 CDD:330997 65/295 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.