DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and MDAR6

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_849839.1 Gene:MDAR6 AraportID:AT1G63940 Length:493 Species:Arabidopsis thaliana

Alignment Length:443 Identity:106/444 (24%)
Similarity:177/444 (40%) Gaps:77/444 (17%)


  Fly   130 DQRHFVVVGGGPSGAVCVETLRQEGFT-GRLTLVCGEKHLPYDRTRIMNLLNTYTKNLALREEQ- 192
            :.|.||:||||.:......|..:.|.. |||.:|..|.:.||:|..:       ||......|: 
plant    59 ENREFVIVGGGNAAGYAARTFVENGMADGRLCIVTKEAYAPYERPAL-------TKAYLFPPEKK 116

  Fly   193 ---------------------FYKDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGY 236
                                 :||:.|||:.........|....||....||...|..:.||||.
plant   117 PARLPGFHTCVGGGGERQTPDWYKEKGIEVIYEDPVAGADFEKQTLTTDAGKQLKYGSLIIATGC 181

  Fly   237 SAVT-PNIPGVHLKNVKVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSRARSVTLVA 300
            :|.. |:..|.||..|..||.:.||.|:...:.|:.::|.:|..::.:|..|..|:.....|:|.
plant   182 TASRFPDKIGGHLPGVHYIREVADADSLIASLGKAKKIVIVGGGYIGMEVAAAAVAWNLDTTIVF 246

  Fly   301 RQNVPFKSTLGELIGQRILKLLEENKVDLRMSSGIIRILGNSRGEVVAVKLLDNSRIPCNLLILG 365
            .::...:......:.|:..:|..:|.|.....:.|..:...|.|.|.||||.|.|.|..:.:::|
plant   247 PEDQLLQRLFTPSLAQKYEELYRQNGVKFVKGASINNLEAGSDGRVSAVKLADGSTIEADTVVIG 311

  Fly   366 TGCQCNTDFLQRSGININPNGSVDVNDFLQTKVRNVYVGGDIANAYILGGFPDRVNISHYGLAQY 430
            .|.:......:...:| ...|.:.|:...:|....::..||:| |:.|..:.....:.|..    
plant   312 IGAKPAIGPFETLAMN-KSIGGIQVDGLFRTSTPGIFAIGDVA-AFPLKIYDRMTRVEHVD---- 370

  Fly   431 HGRIAALN-----MSGHIAKLEAIPFFYTVIFGRAFRSAGYGPFKDVVIDGSLEDLQFVAYFFDD 490
            |.|.:|.:     ::.|....:.:|:||:.:|               ..:||...:.: .:|.|:
plant   371 HARRSAQHCVKSLLTAHTDTYDYLPYFYSRVF---------------EYEGSPRKVWW-QFFGDN 419

  Fly   491 YDKVTAVASCGRDPMVAQF--------AELVSQGK--------ELCRCQ-IVD 526
            ..:...|.:.  ||.:|.|        ..||..|.        :|.|.| :||
plant   420 VGETVEVGNF--DPKIATFWIESGRLKGVLVESGSPEEFQLLPKLARSQPLVD 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 78/303 (26%)
Pyr_redox 273..350 CDD:278498 17/77 (22%)
COG3393 336..>508 CDD:225928 38/177 (21%)
Reductase_C 464..527 CDD:291425 17/81 (21%)
MDAR6NP_849839.1 Pyr_redox_2 83..376 CDD:285266 75/306 (25%)
Pyr_redox 218..300 CDD:278498 20/82 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I1950
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D405030at2759
OrthoInspector 1 1.000 T32200
orthoMCL 1 0.900 OOG5_126784
Panther 1 1.100 O PTHR43557
Phylome 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.