DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and Aifm1

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_112646.1 Gene:Aifm1 RGDID:620817 Length:612 Species:Rattus norvegicus

Alignment Length:427 Identity:97/428 (23%)
Similarity:179/428 (42%) Gaps:91/428 (21%)


  Fly   134 FVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLL-----NTYTKNLALRE--- 190
            |:::|||.:......::|......|:.:|..:..|||.|..:...|     ...||.|..|:   
  Rat   133 FLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNG 197

  Fly   191 ---------EQFY---------KDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATG-- 235
                     ..||         ::.|:.:..|.....||...|.:...:|....::|..||||  
  Rat   198 KERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGT 262

  Fly   236 ---YSAVTPNIPGVHLKN-VKVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSRARSV 296
               .||:  :..|..:|: ..:.|.|||.|::.|:..:...:..:|..|:..|....|..::::.
  Rat   263 PRSLSAI--DRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQAS 325

  Fly   297 TLVARQNVPFKSTLGELIGQRI----LKLLEENKVDLRMSSGIIRILGNSRGEVVAVKLLDNSRI 357
            .:...|..|.|..:|:::.:.:    ::.::...|.: |.:.|::.:|.|.|::: :||.|..::
  Rat   326 GIEVIQLFPEKGNMGKILPEYLSNWTMEKVKREGVKV-MPNAIVQSVGVSGGKLL-IKLKDGRKV 388

  Fly   358 PCNLLILGTGCQCNTDFLQRSGININPN-GSVDVNDFLQTKVRNVYVGGDIANAY--ILGGFPDR 419
            ..:.::...|.:.|.:..:..|:.|:.: |...||..||.: .|::|.||.|..|  .||    |
  Rat   389 ETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQAR-SNIWVAGDAACFYDIKLG----R 448

  Fly   420 VNISHYGLAQYHGRIAALNMSGHIAKLEAIPFFYTVIFGRAFRSAGYGPFKDV------VIDGSL 478
            ..:.|:..|...||:|..||:|     .|.|:::..:|.     :..||  ||      ::|.||
  Rat   449 RRVEHHDHAVVSGRLAGENMTG-----AAKPYWHQSMFW-----SDLGP--DVGYEAIGLVDSSL 501

  Fly   479 EDLQFVAYFFDDYDKVTAVASCGRDPMVAQFAELVSQ 515
                                     |.|..||:..:|
  Rat   502 -------------------------PTVGVFAKATAQ 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 71/318 (22%)
Pyr_redox 273..350 CDD:278498 14/81 (17%)
COG3393 336..>508 CDD:225928 44/181 (24%)
Reductase_C 464..527 CDD:291425 12/59 (20%)
Aifm1NP_112646.1 FAD-dependent oxidoreductase. {ECO:0000250} 133..482 85/363 (23%)
Pyr_redox_2 149..446 CDD:285266 67/302 (22%)
Pyr_redox 301..385 CDD:278498 17/86 (20%)
Nuclear localization signal. {ECO:0000255} 445..450 3/9 (33%)
AIF_C 464..592 CDD:291391 19/88 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.