DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and ATMDAR2

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_568125.1 Gene:ATMDAR2 AraportID:AT5G03630 Length:435 Species:Arabidopsis thaliana

Alignment Length:445 Identity:109/446 (24%)
Similarity:172/446 (39%) Gaps:87/446 (20%)


  Fly   134 FVVVGGG-PSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRI----------MNLLNTYTKNLA 187
            :|:|||| .:|....|...|....|.|.::..|:..||:|..:          ..|.|.|.....
plant     9 YVIVGGGVAAGYAAREFFNQGVKPGELAIISREQVPPYERPALSKGYIHLENKATLPNFYVAAGI 73

  Fly   188 LREEQF---YKDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPN---IPGV 246
            ..|.||   ||:.|||:.||....:.|....||....|:.|.|..:..|||.|.:..:   :||.
plant    74 GGERQFPQWYKEKGIELILGTEIVKADLAAKTLVSGTGQVFKYQTLLAATGSSVIRLSDFGVPGA 138

  Fly   247 HLKNVKVIRNIGDARSI-FKMVDKST-QVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKST 309
            ..||:..:|.:.||..: :.|..|.. :.|.:|..::.:|..|.|.:....||:|    .|....
plant   139 DAKNIFYLRELEDADYLAYAMETKEKGKAVVVGGGYIGLELGAALKANNLDVTMV----YPEPWC 199

  Fly   310 LGELIGQRILKLLEE-------NKVDLRMSSGIIRILGNSRGEVVAVKLLDNSRIPCNLLILGTG 367
            :..|....|....|.       |.|...::||...   ||.|||..|||.|...:..:::|:|.|
plant   200 MPRLFTAGIASFYEGYYANKGINIVKGTVASGFTT---NSNGEVTEVKLKDGRTLEADIVIVGVG 261

  Fly   368 CQCNTDFLQRSGINI------NPNGSVDVNDFLQTKVRNVYVGGDIANAYILGGFPDRV-----N 421
                    .|..|::      ...|.:..:.|.:|.:.:||..||:|.      ||.::     .
plant   262 --------GRPIISLFKDQVEEEKGGLKTDGFFKTSLPDVYAIGDVAT------FPMKLYNEMRR 312

  Fly   422 ISHYGLAQYHGR---------IAALNMSGHIAKLEAIPFFYTVIFGRAFRSAGYGPFKDVVI--- 474
            :.|..    |.|         |.|......|.:.:.:|:||:..|..:::..|....:.|:.   
plant   313 VEHVD----HARKSAEQAVKAIKAAEEGNSIPEYDYLPYFYSRAFDLSWQFYGDNVGESVLFGDN 373

  Fly   475 DGSLEDLQFVAYFFDDYDKV------------TAVASCGR-DPMVAQFAELVSQG 516
            |......:|.:|:..:...|            .|:|...| .|.|.....|..:|
plant   374 DPESPKPKFGSYWIKERKVVGAFLEGGSPEENNAIAKLARAQPSVESLEVLSKEG 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 84/311 (27%)
Pyr_redox 273..350 CDD:278498 22/84 (26%)
COG3393 336..>508 CDD:225928 45/208 (22%)
Reductase_C 464..527 CDD:291425 13/70 (19%)
ATMDAR2NP_568125.1 Pyr_redox_2 33..323 CDD:285266 81/315 (26%)
Pyr_redox 166..248 CDD:278498 25/89 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I1950
OMA 1 1.010
OrthoDB 1 1.010 D405030at2759
OrthoInspector 1 1.000 T32200
orthoMCL 1 0.900 OOG5_126784
Panther 1 1.100 O PTHR43557
Phylome 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.