DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and MDAR1

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001154674.1 Gene:MDAR1 AraportID:AT3G52880 Length:466 Species:Arabidopsis thaliana

Alignment Length:471 Identity:107/472 (23%)
Similarity:172/472 (36%) Gaps:101/472 (21%)


  Fly   105 VLVQVKRSYLLRHARIKSMACRNWQDQRHFVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLP 169
            :|:.|::.||.:      :.|| |.            .|....|...|....|.|.::..|...|
plant    31 LLLSVRKVYLCK------ITCR-WL------------IGYAAKEFANQGVQPGELAVISKEAVAP 76

  Fly   170 YDRTRIMNLLNTYTKNLALRE--------------------EQFYKDYGIEMQLGVSAERLDTNC 214
            |:|..:       :|.....|                    .:.||..|||:.|.....:.|.:.
plant    77 YERPAL-------SKGYLFPEGAARLPGFHCCVGSGGEKLLPESYKQKGIELILSTEIVKADLSA 134

  Fly   215 NTLHCTNGKTFPYDKIYIATGYSAVTP---NIPGVHLKNVKVIRNIGDARSIFKMV--DKSTQVV 274
            .:|....|..|.|..:.||||.:.:..   .:.|...||:..:|.|.||..:.:.:  .|..:.|
plant   135 KSLVSATGDVFKYQTLIIATGSTVLRLTDFGVKGADSKNILYLREIDDADKLVEAIKAKKGGKAV 199

  Fly   275 CLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQRILKLLE---ENKVDLRMSSGII 336
            .:|..::.:|.:|.|......||:|    .|....:..|....|....|   .|| .:::..|.:
plant   200 VVGGGYIGLELSAVLRINNLDVTMV----FPEPWCMPRLFTADIAAFYETYYTNK-GVKIIKGTV 259

  Fly   337 R--ILGNSRGEVVAVKLLDNSRIPCNLLILGTGCQCNTDFLQRSGININPNGSVDVNDFLQTKVR 399
            .  ......|||..|:|.|...:..:::|:|.|.:..|...:  |......|.:..:.|.:|.|.
plant   260 ASGFTAQPNGEVKEVQLKDGRTLEADIVIVGVGAKPLTSLFK--GQVEEDKGGIKTDAFFKTSVP 322

  Fly   400 NVYVGGDIANAYILGGFP----------DRVNISHYGLAQYHGRIAALNMSGHIAKLEAIPFFYT 454
            :||..||:|.      ||          :.|:.|.....|....|.|......:.:.:.:||||:
plant   323 DVYAVGDVAT------FPLKMYGDVRRVEHVDHSRKSAEQAVKAIKAAEGGAAVEEYDYLPFFYS 381

  Fly   455 VIFGRAFRSAGYGP-FKDVVIDG----SLEDLQFVAYFFD--------------DYDKVTAVASC 500
            ..|..:::.  ||. ..|.|:.|    |....:|.||:..              |.:|..|..:.
plant   382 RSFDLSWQF--YGDNVGDSVLFGDSNPSNPKPRFGAYWVQGGKVVGAFMEGGSGDENKALAKVAK 444

  Fly   501 GRDPMVAQFAELVSQG 516
            .| |......|||.||
plant   445 AR-PSAESLDELVKQG 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 0/1 (0%)
Pyr_redox_2 135..414 CDD:285266 69/309 (22%)
Pyr_redox 273..350 CDD:278498 19/82 (23%)
COG3393 336..>508 CDD:225928 46/203 (23%)
Reductase_C 464..527 CDD:291425 19/73 (26%)
MDAR1NP_001154674.1 Pyr_redox_2 50..354 CDD:285266 73/324 (23%)
NADB_Rossmann 205..279 CDD:304358 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I1950
OMA 1 1.010
OrthoDB 1 1.010 D405030at2759
OrthoInspector 1 1.000 T32200
orthoMCL 1 0.900 OOG5_126784
Panther 1 1.100 O PTHR43557
Phylome 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.