DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and MDAR4

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_189420.1 Gene:MDAR4 AraportID:AT3G27820 Length:488 Species:Arabidopsis thaliana

Alignment Length:397 Identity:108/398 (27%)
Similarity:175/398 (44%) Gaps:68/398 (17%)


  Fly   134 FVVVGGG-PSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLALRE------- 190
            :|::||| .:|...:|..|:....|.|.::..|...||:|..:       :|...|.|       
plant     7 YVILGGGVAAGYAALEFTRRGVSDGELCIISEEPVAPYERPAL-------SKGFLLPEAPARLPS 64

  Fly   191 -------------EQFYKDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTP- 241
                         .::|||:|||:.||...:.:|....||..:.|:|..|..:.||||..|:.. 
plant    65 FHTCVGANDEKLTPKWYKDHGIELVLGTRVKSVDVRRKTLLSSTGETISYKFLIIATGARALKLE 129

  Fly   242 --NIPGVHLKNVKVIRNIGDARSIFKMVDKST--QVVCLGSSFMAVEATANLVSRARSVTLVARQ 302
              .:.|...:||..:|::.||..:..::..|:  ..|.:|..::.:|..|:||....:||:|   
plant   130 EFGVEGSDAENVCYLRDLADANRLATVIQSSSNGNAVVIGGGYIGMECAASLVINKINVTMV--- 191

  Fly   303 NVPFKSTLGELIGQRILKLLEENKVDLRMSSGIIRILG--------NSRGEVVAVKLLDNSRIPC 359
             .|....:..|...:|..|.|    |...:.|:..|.|        :|..:|.||.|.|.|.:|.
plant   192 -FPEAHCMARLFTPKIASLYE----DYYRAKGVKFIKGTVLTSFEFDSNKKVTAVNLKDGSHLPA 251

  Fly   360 NLLILGTGCQCNTDFLQRSGININPNGSVDVNDFLQTKVRNVYVGGDIANAYILGGFPDRV---- 420
            :|:::|.|.:.||...:  |......|.:.||..:|:...:||..||:|.      ||.::    
plant   252 DLVVVGIGIRPNTSLFE--GQLTIEKGGIKVNSRMQSSDSSVYAIGDVAT------FPVKLFGEM 308

  Fly   421 -NISHYGLAQYHGR--IAALNMSGHIAKLEAIPFFYTVIFGRAFRSAGYG-PFKDVVIDGSLED- 480
             .:.|...|:...|  ::|:.........:.:||||:.:|  ||....|| |..|||..|..|| 
plant   309 RRLEHVDSARKSARHAVSAIMDPIKTGDFDYLPFFYSRVF--AFSWQFYGDPTGDVVHFGEYEDG 371

  Fly   481 LQFVAYF 487
            ..|.||:
plant   372 KSFGAYW 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 83/313 (27%)
Pyr_redox 273..350 CDD:278498 22/85 (26%)
COG3393 336..>508 CDD:225928 50/170 (29%)
Reductase_C 464..527 CDD:291425 12/27 (44%)
MDAR4NP_189420.1 Pyr_redox_2 30..321 CDD:285266 80/314 (25%)
Pyr_redox 164..246 CDD:278498 24/90 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H135034
Inparanoid 1 1.050 117 1.000 Inparanoid score I1950
OMA 1 1.010
OrthoDB 1 1.010 D405030at2759
OrthoInspector 1 1.000 T32200
orthoMCL 1 0.900 OOG5_126784
Panther 1 1.100 O PTHR43557
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.