DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and aifm4

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_005157647.1 Gene:aifm4 ZFINID:ZDB-GENE-070112-2282 Length:530 Species:Danio rerio

Alignment Length:522 Identity:191/523 (37%)
Similarity:308/523 (59%) Gaps:24/523 (5%)


  Fly    11 VVCHKLEVQENEMRQ--VDASGIPSILLVKQSGILRAVGAMCPHRGAPLAKGVLSRNRVRCPWHG 73
            :||.:.::|:.:|::  ||.:   .||||:.:|...|||.:|.|.||||.||.|..:|||||:||
Zfish    12 MVCLESDLQDGQMKEVLVDEN---KILLVRNNGEFTAVGGLCSHYGAPLIKGTLIGDRVRCPFHG 73

  Fly    74 VCFNLETGDIENFPGLDSLPCHRVNVDSRGQVLVQVKRSYLLRHARIKSMACRNWQDQRHFVVVG 138
            .|||.:|||||.|||||.||..:|.||. |:|.|...:..|.:  |:|.|:.|........|::|
Zfish    74 ACFNTKTGDIEEFPGLDCLPKFKVKVDG-GKVYVTSDQKNLKK--RVKKMSSRVPGVNHTVVLIG 135

  Fly   139 GGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLALREEQFYKDYGIEMQL 203
            |||:...|.|||||..:.||:.:|..::.||.|:|::...:|...:.:.||:..|.:.||||:..
Zfish   136 GGPASLQCAETLRQNDYGGRIVMVTKDEQLPLDKTKLSKAMNIEIEKVLLRQSDFLQQYGIEVWT 200

  Fly   204 GVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGVHLKNVKVIRNIGDARSIFKMVD 268
            ....:.:||:..|:...:|....||::.|:||..|.....||..|:|||:::...||..|.: :.
Zfish   201 KKEVKSVDTDAKTVTFQDGTLQNYDQLLISTGGRARPLECPGAELENVKLLQTYEDASEIHR-IS 264

  Fly   269 KSTQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQRILKLLEENKVDLRMSS 333
            ...:.|.:|:||:.:|..|.|..:|.|||::.....||:::||..||:..:::|||..|....|:
Zfish   265 AGKKAVIVGTSFIGMEVAAYLSDKAASVTVIGTSKFPFQASLGSDIGKMTMQMLEEKNVKFYTSN 329

  Fly   334 GIIRILGNSRGEVVAVKLLDNSRIPCNLLILGTGCQCNTDFLQRSGININPNGSVDVNDFLQTKV 398
            |:..|.|.: |:|..|.|.:...:|.:::|.|.|...|:|||:.:.:.|:.:.:|.|:.|::|.:
Zfish   330 GVAEIRGEN-GKVKEVVLKNGEVLPADIIIAGIGVIPNSDFLKETLVEIDSHKAVVVDKFMKTNI 393

  Fly   399 RNVYVGGDIANAYILGGFP------DRVNISHYGLAQYHGRIAALNMSGHIAKLEAIPFFYTVIF 457
            .:|:..||:.:      ||      .||||.|:.|||.|||||.|:|.....::..:|:|:|::.
Zfish   394 PDVFAAGDVVS------FPLTLVGHKRVNIGHWQLAQAHGRIAGLSMLNRQVEINTVPYFWTMLL 452

  Fly   458 GRAFRSAGYGP-FKDVVIDGSLEDLQFVAYFFDDYDKVTAVASCGRDPMVAQFAELVSQGKELCR 521
            |::.|..|||. :.::|..||.|:.:|:|::..| ::|.|.||...||.||:.||::..||.:.:
Zfish   453 GKSIRYTGYGEGYTEIVFKGSTEERKFLAFYIKD-EEVVAAASLNFDPAVARLAEMLLMGKRITK 516

  Fly   522 CQ 523
            .|
Zfish   517 AQ 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 50/97 (52%)
Pyr_redox_2 135..414 CDD:285266 90/279 (32%)
Pyr_redox 273..350 CDD:278498 28/77 (36%)
COG3393 336..>508 CDD:225928 62/179 (35%)
Reductase_C 464..527 CDD:291425 23/62 (37%)
aifm4XP_005157647.1 Rieske_AIFL_N 13..105 CDD:239560 50/96 (52%)
Pyr_redox_2 129..427 CDD:285266 101/306 (33%)
TIM_phosphate_binding <132..277 CDD:304361 49/146 (34%)
Pyr_redox 268..349 CDD:278498 29/82 (35%)
Reductase_C 446..519 CDD:291425 27/75 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79897197
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 396 1.000 Inparanoid score I1873
OMA 1 1.010
OrthoDB 1 1.010 D183405at33208
OrthoFinder 1 1.000 FOG0002264
OrthoInspector 1 1.000 T128754
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43557
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R33
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1010.040

Return to query results.
Submit another query.