DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and txnrd3

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001340296.1 Gene:txnrd3 XenbaseID:XB-GENE-973837 Length:598 Species:Xenopus tropicalis

Alignment Length:433 Identity:88/434 (20%)
Similarity:153/434 (35%) Gaps:133/434 (31%)


  Fly   135 VVVGGGPSGAVCVETLRQEGFTGRLTLV-----------------------CGEKHLPYD----- 171
            :|:|||..|..|   .::....|:..:|                       |..|.|.:.     
 Frog   115 IVIGGGSGGLAC---SKEAASFGKKVMVLDYVVPTPKGTSWGLGGTCVNVGCIPKKLMHQAAILG 176

  Fly   172 ------------------------RTRIMNLLNT--YTKNLALREEQ--FYKDYGIEMQLGVSAE 208
                                    |..|.|.:.:  :...::||::|  :...||         |
 Frog   177 QSLKDSRKFGWEYEEQVKHNWDTMREAIQNYIGSLNWGYRVSLRDKQVRYENAYG---------E 232

  Fly   209 RLDTNCNTLHCTN--GKT--FPYDKIYIATGYSAVTPNIPGVHLKNVKVIRNIGDARSIFKMVDK 269
            .::.  :.:..||  ||.  |..:|..:|||......||||.  |...:..:     .:|.:...
 Frog   233 FVEP--HKIKATNKRGKESFFTAEKFVVATGERPRYLNIPGD--KEYCITSD-----DLFSLPYC 288

  Fly   270 STQVVCLGSSFMAVEATANLVSRARSVTLVARQNV-------------PFKSTLG-ELIGQRI-- 318
            ..:.:.:|:|::|:|....|.......|::.|..:             .:..|.| :.|.|.:  
 Frog   289 PGKTLVVGASYVALECAGFLAGLGLDATVMVRSILLRGFDQEMANRAGAYMETHGVKFIKQFVPI 353

  Fly   319 -LKLLEENKVDLRMSSGIIRILGNSRGEVVAVKLLDNSRI---PCNLLILGTG---CQCNTDFLQ 376
             ::||||.      :.|.::         |..|..:..:|   ..|.:::..|   |..|.. |:
 Frog   354 SVELLEEG------TPGRLK---------VTAKATEGDQIIEDEYNTVLIAVGRDACTRNIG-LE 402

  Fly   377 RSGININP-NGSVDVNDFLQTKVRNVYVGGDIANAYILGGFPDRVNISHYGLAQYHGRIAALNM- 439
            :.|:.:|. ||.:.|:|..||.|..||..|||.:.          .:....:|...||:.|..: 
 Frog   403 KIGVKVNERNGKIPVSDEEQTSVPYVYAIGDILDG----------KLELTPVAIQAGRLLARRLY 457

  Fly   440 SGHIAKLEAIPFFYTVIFGRAFRSAGYGPFKDVVIDGSLEDLQ 482
            .|...|.:.:....||.....:...||...|.:.|.|. |:|:
 Frog   458 KGSKLKCDYVNVPTTVFTPLEYGCCGYAEEKAIEIYGE-ENLE 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 73/363 (20%)
Pyr_redox 273..350 CDD:278498 17/94 (18%)
COG3393 336..>508 CDD:225928 37/156 (24%)
Reductase_C 464..527 CDD:291425 7/20 (35%)
txnrd3NP_001340296.1 GRX_GRXh_1_2_like 21..102 CDD:239511
TGR 110..598 CDD:273624 88/434 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80281832
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.