DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and Aifm3

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_006522653.1 Gene:Aifm3 MGIID:1919418 Length:610 Species:Mus musculus

Alignment Length:525 Identity:195/526 (37%)
Similarity:301/526 (57%) Gaps:23/526 (4%)


  Fly    12 VCHKLEVQENEMRQVDASGIPSILLVKQSGILRAVGAMCPHRGAPLAKGVLSRNRVRCPWHGVCF 76
            |||..:::..:||:|:. |...:||||.:|...|:|..|||.||||.||||||.||||||||.||
Mouse    72 VCHVKDLENGQMREVEL-GWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACF 135

  Fly    77 NLETGDIENFPGLDSLPCHRVNVDSRGQVLVQVKRSYLLRHARIKSMA-C----RNWQDQRHFVV 136
            |:.|||:|:|||||||...:|.:: :.:|.::..:..|....|.|.|| |    .......:.::
Mouse   136 NISTGDLEDFPGLDSLHKFQVKIE-KEKV
TIRASKQALQLQRRTKVMAKCISPSAGHSSSTNVLI 199

  Fly   137 VGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLALREEQFYKDYGIEM 201
            ||.|.:|.||.||||||||:.|:.|...::||||||.::...|:...:.||||.::|::.|||||
Mouse   200 VGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRAKLSKSLDAQPEQLALRPKEFFRAYGIEM 264

  Fly   202 QLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGVHLKNVKVIRNIGDARSIFKM 266
            ........:|.....:...:|....|.|:.:|.|.|..|....|..::||..||...||..:.::
Mouse   265 LTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSSPKTLTCKGKDVENVFTIRTPEDANRVLRL 329

  Fly   267 VDKSTQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQRILKLLEENKVDLRM 331
            . :....|.:|:.|:.:|..|.|..:|.||::|..:..||:..|||.:|:.::|:.|.|:|...|
Mouse   330 A-RGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYM 393

  Fly   332 SSGIIRILGNSRGEVVAVKLLDNSRIPCNLLILGTGCQCNTDFLQRSGININPNGSVDVNDFLQT 396
            .:.:.. |....|::..|.|..:..:..::.:||.|....|.||::|||.::..|.:.||..:||
Mouse   394 QTEVSE-LRAQEGKLQEVVLKSSKVLRADVCVLGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQT 457

  Fly   397 KVRNVYVGGDIANAYILGGFP------DRVNISHYGLAQYHGRIAALNMSGHIAKLEAIPFFYTV 455
            .|..|:..||...      ||      .:|||.|:.:|...||:||.||....|::..:|:.:|.
Mouse   458 NVPGVFAAGDAVT------FPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEINTVPYLWTA 516

  Fly   456 IFGRAFRSAGYGP-FKDVVIDGSLEDLQFVAYFFDDYDKVTAVASCGRDPMVAQFAELVSQGKEL 519
            :||::.|.||||. |.||:|.|.||:|:||| |:...|:|.||||...||:|::.||:::.|:.:
Mouse   517 MFGKSLRYAGYGEGFDDVIIQGDLEELKFVA-FYTKSDEVIAVASMNYDPIVSKVAEVLASGRAI 580

  Fly   520 CRCQI 524
            .:.::
Mouse   581 RKREV 585

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 51/94 (54%)
Pyr_redox_2 135..414 CDD:285266 91/279 (33%)
Pyr_redox 273..350 CDD:278498 24/77 (31%)
COG3393 336..>508 CDD:225928 66/179 (37%)
Reductase_C 464..527 CDD:291425 28/63 (44%)
Aifm3XP_006522653.1 Rieske_AIFL_N 70..163 CDD:239560 50/93 (54%)
Pyr_redox_2 195..493 CDD:285266 98/306 (32%)
NADB_Rossmann 196..285 CDD:304358 34/89 (38%)
Pyr_redox 334..414 CDD:278498 25/81 (31%)
Reductase_C 512..>562 CDD:291425 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80212731
eggNOG 1 0.900 E1_COG0446
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 369 1.000 Inparanoid score I2119
Isobase 1 0.950 0 Normalized mean entropy S3886
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002264
OrthoInspector 1 1.000 T616289
orthoMCL 1 0.900 OOG5_126784
Panther 1 1.100 O PTHR43557
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R33
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.