DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and Txnrd1

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001338913.1 Gene:Txnrd1 RGDID:61959 Length:580 Species:Rattus norvegicus

Alignment Length:351 Identity:75/352 (21%)
Similarity:118/352 (34%) Gaps:97/352 (28%)


  Fly   186 LALREEQFYKDYGIEMQLGVSAERLDTNCNTLHCTNG----KTFPYDKIYIATGYSAVTPNIPGV 246
            :||||::...:......:|.         :.:..||.    |.:..::..||||.......|||.
  Rat   199 VALREKKVVYENAYGKFIGP---------HKIMATNNKGKEKVYSAERFLIATGERPRYLGIPGD 254

  Fly   247 HLKNVKVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSRARSVTLVARQNV--PFKST 309
              |...:     .:..:|.:.....:.:.:|:|::|:|....|......||::.|..:  .|...
  Rat   255 --KEYCI-----SSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQD 312

  Fly   310 LGELIGQRILKLLEENKVD-LR--MSSGIIRILGNSRGEVVAVKLLDNSRIPCN------LLILG 365
            :...||:.    :||:.:. :|  :.:.|.:|...:.|.:.......||.....      ||.:|
  Rat   313 MANKIGEH----MEEHGIKFIRQFVPTKIEQIEAGTPGRLKVTAKSTNSEETIEDEFNTVLLAVG 373

  Fly   366 TGCQCNTDFLQRSGININ-PNGSVDVNDFLQTKVRNVYVGGDIANAYILGGFPDRVNISHYGLAQ 429
            ......|..|:..|:.|| ..|.:.|.|..||.|..:|..|||..                    
  Rat   374 RDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILE-------------------- 418

  Fly   430 YHGRIAALNMSGHIAKLEAIPFFYTVIFGRAFRSAGYGPFKDVVIDGSLEDLQFVAYFFDDYDKV 494
                          .|||..|  ..:..||......||        ||....        |||.|
  Rat   419 --------------GKLELTP--VAIQAGRLLAQRLYG--------GSTVKC--------DYDNV 451

  Fly   495 -TAV------ASCG--RDPMVAQFAE 511
             |.|      ..||  .:..|.:|.|
  Rat   452 PTTVFTPLEYGCCGLSEEKAVEKFGE 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 54/244 (22%)
Pyr_redox 273..350 CDD:278498 17/82 (21%)
COG3393 336..>508 CDD:225928 41/188 (22%)
Reductase_C 464..527 CDD:291425 15/58 (26%)
Txnrd1NP_001338913.1 TGR 92..580 CDD:273624 75/352 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79845485
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.