DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and aifm2

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001186939.1 Gene:aifm2 ZFINID:ZDB-GENE-050506-76 Length:373 Species:Danio rerio

Alignment Length:426 Identity:96/427 (22%)
Similarity:164/427 (38%) Gaps:124/427 (29%)


  Fly   133 HFVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNL-ALR------- 189
            |.|:||||..|....:.|:..|             :|:   .::::|:.:..|: |||       
Zfish    12 HVVIVGGGFGGIAAAQHLKHYG-------------VPF---MLIDVLDAFHHNVAALRASVQTGF 60

  Fly   190 -EEQF--YKD-YGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGVHLKN 250
             .:.|  ||: :|:....| ...|:||...|:...|||...|..:.:.||   .|.:.|..| .:
Zfish    61 ARKTFIPYKETFGLNFLQG-RVIRIDTETQTVVLDNGKEVRYSHLILCTG---TTGSFPSKH-NS 120

  Fly   251 VKVIRN-IGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVS--RARSVTLVARQNVPFKSTLGE 312
            |...:: |......|.::.::..:|.:|.....||..|.:.:  ..:.|.|:..:.        |
Zfish   121 VDTYKSAIQKYEDFFHVIKEANAIVVVGGGTTGVEMAAEIKTEFHDKKVVLIHPRE--------E 177

  Fly   313 LIGQRILKLLEENKVDLRMSSGIIRILGNSRGEV-----------VAVKLLDNSRIPCNLLILGT 366
            :....:|..::|....:.:..|:..:||.....:           :.||...|.::..:|:|..|
Zfish   178 VADPELLPCVKEQAKQVLLEKGVELLLGQKVSNLEELELNVCRSGMVVKTNKNEQVTTDLVICCT 242

  Fly   367 GCQCNTDFLQRSGIN--INPNGSVDVNDFLQTK-VRNVYVGGDIAN------AYILGGFPDRVNI 422
            |.:.|:: ..||.::  :..||::.||..||.: ..|||..||.||      ||           
Zfish   243 GSKINSE-AYRSSMSSCLAENGALKVNKHLQVEGFDNVYAVGDCANLSEPKMAY----------- 295

  Fly   423 SHYGLAQYHGRIAALNMSGHIAKLEAIPFFYTVIFGRAFRSAGYGPFKDVVIDGSLEDLQFVAYF 487
             |.||   |..:||.|:...::             |:|..|...|                    
Zfish   296 -HAGL---HAGVAATNIINSLS-------------GKALTSYKTG-------------------- 323

  Fly   488 FDDYDKVTAVASCGRDPMVAQF------AELVSQGK 517
                 .||.:.:.|:|..|.||      ..||::||
Zfish   324 -----NVTMLIAMGKDAGVGQFNGYKLPRFLVTKGK 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 73/314 (23%)
Pyr_redox 273..350 CDD:278498 14/90 (16%)
COG3393 336..>508 CDD:225928 43/192 (22%)
Reductase_C 464..527 CDD:291425 12/61 (20%)
aifm2NP_001186939.1 Pyr_redox_2 19..301 CDD:285266 73/327 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.