DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and aifm5

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_001920911.2 Gene:aifm5 ZFINID:ZDB-GENE-091118-96 Length:543 Species:Danio rerio

Alignment Length:529 Identity:187/530 (35%)
Similarity:310/530 (58%) Gaps:23/530 (4%)


  Fly     7 IDPV-----VVCHKLEVQENEMRQVDASGIPSILLVKQSGILRAVGAMCPHRGAPLAKGVLSRNR 66
            :||.     |||...::::.||.:|:. |..::|||:..|:..|:...|.|.||||::||||..|
Zfish    12 LDPEEEVTNVVCDDADLRDGEMMEVEV-GDHNVLLVRCDGVYSAISNQCTHYGAPLSEGVLSGCR 75

  Fly    67 VRCPWHGVCFNLETGDIENFPGLDSLPCHRVNVDSRGQVLVQVKRSYLLRHARIKSMACRNWQDQ 131
            |||||||.|||::|||:|.:||:|.||||:|.|:: .:|.|.||:....:..|:|.|..|:....
Zfish    76 VRCPWHGSCFNVKTGDLEEYPGIDCLPCHKVKVEN-NKVYVSVKKRIRGQPKRVKWMGVRDQSVS 139

  Fly   132 RHFVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLALREEQFYKD 196
            ...:::|||.:..:|.||||||.:.||:.:|..:..||||:||:..::|..:.:|.:|...|:..
Zfish   140 HTVMLLGGGAACLMCAETLRQENYGGRIIMVSRDDLLPYDKTRLSKVMNAESDSLLMRRMDFFHK 204

  Fly   197 YGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGVHLKNVKVIRNIGDAR 261
            :.||:.|...|..:|||..|:...:|....||:|.||||..|...:.||.:|:.|.::....|||
Zfish   205 HDIEVWLKKEALSIDTNKKTVTFDDGLIQSYDQILIATGCRAKGLDCPGANLERVLMLETPEDAR 269

  Fly   262 SIFKMVDKSTQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQRILKLLEENK 326
            .: .......:.|.:|:||:.:|..|.|:..:.|:|::....:|::.|||..||:..:.:|||..
Zfish   270 CV-HYACTGCRTVIVGTSFIGMEVAAYLLDTSSSMTVIGSSELPYQKTLGREIGKVTMTMLEEKG 333

  Fly   327 VDLRMSSGIIRILGNSRGEVVAVKLLDNSRIPCNLLILGTGCQCNTDFLQRSGININPNGSVDVN 391
            |...|:..:..:.|.:| .|.||||.....|..:|||:..|...|::||:.|.:.::....|.|:
Zfish   334 VTFYMNDAVAEVQGKNR-RVKAVKLKSGITIEADLLIVAIGVSPNSEFLKGSRVRMDSKNYVIVD 397

  Fly   392 DFLQTKVRNVYVGGDIANAYILGGFP------DRVNISHYGLAQYHGRIAALNMSGHIAKLEAIP 450
            ::::|.:.:||..||:.:      ||      .:|::.|:.:||.|||||||||.....:|..:|
Zfish   398 EYMRTNITDVYCAGDLTS------FPLKMAKGQKVSLGHWQIAQAHGRIAALNMLCREVELNTVP 456

  Fly   451 FFYTVIFGRAFRSAGYGP-FKDVVIDGSLEDLQFVAYFFDDYDKVTAVASCGRDPMVAQFAELVS 514
            :::||:|||..|.||||. :.::|:.|..|:::|:|.:..| .:|.|.|....:|.|:..||.::
Zfish   457 YYWTVLFGRTIRYAGYGEGYTEMVLKGKFENMKFLALYLKD-GEVVAAAGLNVEPAVSVVAERLA 520

  Fly   515 QGKELCRCQ 523
            :|:.:.:.:
Zfish   521 EGRVITKAE 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 47/101 (47%)
Pyr_redox_2 135..414 CDD:285266 90/279 (32%)
Pyr_redox 273..350 CDD:278498 25/77 (32%)
COG3393 336..>508 CDD:225928 61/179 (34%)
Reductase_C 464..527 CDD:291425 18/62 (29%)
aifm5XP_001920911.2 Rieske_AIFL_N 21..114 CDD:239560 47/95 (49%)
Pyr_redox_2 140..438 CDD:285266 97/306 (32%)
Pyr_redox 279..360 CDD:278498 27/82 (33%)
Reductase_C 457..535 CDD:291425 24/75 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79973116
eggNOG 1 0.900 E1_COG0446
Hieranoid 1 1.000
Homologene 1 1.000 H135034
Inparanoid 1 1.050 396 1.000 Inparanoid score I1873
OMA 1 1.010
OrthoDB 1 1.010 D183405at33208
OrthoFinder 1 1.000 FOG0002264
OrthoInspector 1 1.000 T128754
orthoMCL 1 0.900 OOG5_126784
Panther 1 1.100 O PTHR43557
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.