DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and sqor

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_005163218.1 Gene:sqor ZFINID:ZDB-GENE-050417-436 Length:483 Species:Danio rerio

Alignment Length:331 Identity:68/332 (20%)
Similarity:118/332 (36%) Gaps:82/332 (25%)


  Fly   129 QDQRHFVVVGGGPSG-AVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLAL--RE 190
            :|....:|:|||..| |:.....|:.|......:...|.|. |.  .|..|:....|::|.  |.
Zfish    73 KDHYKVLVLGGGSGGIAMAARLKRKVGAENVAIVEPSEMHY-YQ--PIWTLVGAGAKSVASSGRS 134

  Fly   191 EQFYKDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGV-----HLK- 249
            .......|:.......|| .|...||:|...||...||.:.:|.|.......|.|:     |.| 
Zfish   135 TSSVIPSGVTWVKSKVAE-FDPEKNTVHTDCGKKISYDYLIVALGLELHYEKIKGLPEGFEHPKI 198

  Fly   250 ----NVKVIRNIGDARSIFK-----MVDKSTQVVCLGS---------SFMAVEATANLVSRARSV 296
                ::|.:....||...||     ....:|.|.|.|:         :|:            |..
Zfish   199 GSNYSLKTVEKTWDALKSFKEGNALFTFPNTPVKCAGAPQKIMYLSDAFL------------RKT 251

  Fly   297 TLVARQNVPFKSTLGELIGQR-----ILKLLEENKVDLRMSSGIIRILGNSRGEVVAVKLLDNSR 356
            ...::.|:.|.::|..|.|.:     :.:::::..:::.:...:|.:..:.:     ..|.:|..
Zfish   252 GKRSKANIIFNTSLPVLFGVKKYADALWEIVKKRDLNVNLRHNLIEVRADKQ-----EALFENLD 311

  Fly   357 IPCNLLILGTGCQCNTDFLQRSGININP----------------NGSVDVN-DFLQTKV-RNVYV 403
            .|           ..|:..:...:::.|                .|.:||| :.||.|. .||:.
Zfish   312 KP-----------GETEVFKYEMLHVTPPMGPPAVLKGSLLDDAGGWLDVNKNTLQHKTYDNVFG 365

  Fly   404 GGDIAN 409
            .||..|
Zfish   366 IGDCTN 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 67/326 (21%)
Pyr_redox 273..350 CDD:278498 11/91 (12%)
COG3393 336..>508 CDD:225928 18/93 (19%)
Reductase_C 464..527 CDD:291425
sqorXP_005163218.1 FadH2 78..418 CDD:223523 67/327 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.