DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10700 and aifm1

DIOPT Version :10

Sequence 1:NP_609942.1 Gene:CG10700 / 35183 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001017244.1 Gene:aifm1 / 549998 XenbaseID:XB-GENE-1016872 Length:636 Species:Xenopus tropicalis


Alignment Length:37 Identity:8/37 - (21%)
Similarity:16/37 - (43%) Gaps:3/37 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 HFEIFEHIRGFNVTIITSANTQDETLLLWSGFLQKDE 181
            ||.:|.....:::..:.|...   .:|||....:.:|
 Frog   100 HFWMFHSQAVYDINRLDSTGV---NVLLWGNLPEIEE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
NirB 131..519 CDD:440863 8/37 (22%)
aifm1NP_001017244.1 AIF-MLS <67..>114 CDD:464407 3/13 (23%)
NirB 155..619 CDD:440863
AIF_C 487..617 CDD:464279
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.