DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and aifm1

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001017244.1 Gene:aifm1 XenbaseID:XB-GENE-1016872 Length:636 Species:Xenopus tropicalis

Alignment Length:363 Identity:77/364 (21%)
Similarity:153/364 (42%) Gaps:53/364 (15%)


  Fly   134 FVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLL-----------------NT 181
            |:::|||.:......::|......|:.:|..|..|||.|..:...|                 |.
 Frog   156 FLLIGGGTASFAAARSIRARDPGARVLIVSDESELPYMRPPLSKELWFSEDPHVTETLRFKQWNG 220

  Fly   182 YTKNLALREEQFY---------KDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYS 237
            ..:::..:...||         ::.|:.:..|.....:|...|.:...:|....|:|..||||  
 Frog   221 KERSIFFQPPSFYVPPEQLMSVENGGVSVLTGKKVVHMDVRENKVKLDDGTQISYEKCLIATG-- 283

  Fly   238 AVTPNIPGVH------LKNVKVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSRARSV 296
            .|..::|.:.      .|...:.|.|.|.|::..:......:..:|..|:..|....|..:....
 Frog   284 GVPRSLPAIERAGEEVTKRTTLFRRISDFRTLEAISSSVGSITIIGGGFLGSELACALGRKGTQT 348

  Fly   297 TLVARQNVPFKSTLGELIGQRI----LKLLEENKVDLRMSSGIIRILGNSRGEVVAVKLLDNSRI 357
            :|...|..|....:|:::.:.:    .:.::...|:: :|..:::.:....|: :.::|.|..::
 Frog   349 SLEVIQMFPESGNMGKVLPEYLSHWTTEKVQREGVNV-LSDAVVKSVSYQNGK-LHIQLKDGRQV 411

  Fly   358 PCNLLILGTGCQCNTDFLQRSGININPN-GSVDVNDFLQTKVRNVYVGGDIANAY--ILGGFPDR 419
            ..:.::...|.:.||:..:.:|:.::.: |...||..||.: .||:|.||.|..|  .||    |
 Frog   412 QTDHIVAAVGLEPNTELAKSAGLELDGDFGGYRVNAELQAR-NNVWVAGDAACFYDIKLG----R 471

  Fly   420 VNISHYGLAQYHGRIAALNMSGHIAKLEAIPFFYTVIF 457
            ..:.|:..|...||:|..||:|     .|.|:::..:|
 Frog   472 RRVEHHDHAVVSGRLAGENMTG-----AAKPYWHQSMF 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 63/318 (20%)
Pyr_redox 273..350 CDD:278498 11/81 (14%)
COG3393 336..>508 CDD:225928 33/126 (26%)
Reductase_C 464..527 CDD:291425
aifm1NP_001017244.1 Pyr_redox_2 159..469 CDD:285266 62/315 (20%)
Pyr_redox 324..408 CDD:278498 13/86 (15%)
AIF_C 487..616 CDD:291391 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.