| Sequence 1: | NP_609942.1 | Gene: | CG10700 / 35183 | FlyBaseID: | FBgn0032754 | Length: | 539 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001017244.1 | Gene: | aifm1 / 549998 | XenbaseID: | XB-GENE-1016872 | Length: | 636 | Species: | Xenopus tropicalis |
| Alignment Length: | 37 | Identity: | 8/37 - (21%) |
|---|---|---|---|
| Similarity: | 16/37 - (43%) | Gaps: | 3/37 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 145 HFEIFEHIRGFNVTIITSANTQDETLLLWSGFLQKDE 181 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10700 | NP_609942.1 | Rieske_AIFL_N | 10..106 | CDD:239560 | |
| NirB | 131..519 | CDD:440863 | 8/37 (22%) | ||
| aifm1 | NP_001017244.1 | AIF-MLS | <67..>114 | CDD:464407 | 3/13 (23%) |
| NirB | 155..619 | CDD:440863 | |||
| AIF_C | 487..617 | CDD:464279 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||