DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and Txnrd1

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001035988.1 Gene:Txnrd1 MGIID:1354175 Length:613 Species:Mus musculus

Alignment Length:248 Identity:56/249 (22%)
Similarity:97/249 (39%) Gaps:56/249 (22%)


  Fly   186 LALREEQFYKDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIY------IATGYSAVTPNIP 244
            :||||::...:......:|.         :.:..||.|  ..:|||      ||||.......||
Mouse   232 VALREKKVVYENAYGRFIGP---------HRIVATNNK--GKEKIYSAERFLIATGERPRYLGIP 285

  Fly   245 GVHLKNVKVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSRARSVTLVARQ------N 303
            |.  |...:     .:..:|.:.....:.:.:|:|::|:|....|......||::.|.      :
Mouse   286 GD--KEYCI-----SSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFD 343

  Fly   304 VPFKSTLGELIGQRILKLLEE---NKVDLRMSSGI---IRILGNS-------RGEVVAVKLLDNS 355
            ....:.:||.:.:..:|.:.:   .|:: ::.:|.   :|:...|       .||...|      
Mouse   344 QDMANKIGEHMEEHGIKFIRQFVPTKIE-QIEAGTPGRLRVTAQSTNSEETIEGEFNTV------ 401

  Fly   356 RIPCNLLILGTGCQCNTDFLQRSGININ-PNGSVDVNDFLQTKVRNVYVGGDI 407
                 ||.:|......|..|:..|:.|| ..|.:.|.|..||.|..:|..|||
Mouse   402 -----LLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDI 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 56/249 (22%)
Pyr_redox 273..350 CDD:278498 18/96 (19%)
COG3393 336..>508 CDD:225928 23/81 (28%)
Reductase_C 464..527 CDD:291425
Txnrd1NP_001035988.1 TGR 125..613 CDD:273624 56/249 (22%)
Pyr_redox 306..382 CDD:278498 13/77 (17%)
Pyr_redox_dim 485..595 CDD:280934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79843615
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.