| Sequence 1: | NP_609942.1 | Gene: | CG10700 / 35183 | FlyBaseID: | FBgn0032754 | Length: | 539 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_524216.1 | Gene: | Trxr-2 / 40475 | FlyBaseID: | FBgn0037170 | Length: | 516 | Species: | Drosophila melanogaster | 
| Alignment Length: | 430 | Identity: | 79/430 - (18%) | 
|---|---|---|---|
| Similarity: | 128/430 - (29%) | Gaps: | 173/430 - (40%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   135 VVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLALREEQFYKDYGI 199 
  Fly   200 EMQLGVSAERLDTNCNTLHCTNGKTFPYDKIY--IATGYSAVTPNI-PG---------VHLKNVK 252 
  Fly   253 VIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQR 317 
  Fly   318 ILKLLEENKVDLRMSSGIIRILGNSRGEVV--AVKL-------LDNSRIPCNLLILGTG-----C 368 
  Fly   369 QCNTDFLQRSGININPNGSVDVNDFLQTKVRNVYVGGDIANAYILGGFPDRVNISHYGLAQYHGR 433 
  Fly   434 IAALNMSGHIAKL---EAIPFFYTVIFGRAFRSA----------------GYGPFKDVVI----- 474 
  Fly   475 DGSLEDLQFVAYFFDDYDKVTAVASCGRDPMVAQFAELVS 514 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG10700 | NP_609942.1 | Rieske_AIFL_N | 10..106 | CDD:239560 | |
| Pyr_redox_2 | 135..414 | CDD:285266 | 49/304 (16%) | ||
| Pyr_redox | 273..350 | CDD:278498 | 8/78 (10%) | ||
| COG3393 | 336..>508 | CDD:225928 | 45/209 (22%) | ||
| Reductase_C | 464..527 | CDD:291425 | 16/72 (22%) | ||
| Trxr-2 | NP_524216.1 | NADB_Rossmann | 29..>68 | CDD:304358 | 12/62 (19%) | 
| TGR | 31..515 | CDD:273624 | 79/430 (18%) | ||
| NADB_Rossmann | <144..239 | CDD:304358 | 21/129 (16%) | ||
| Pyr_redox | 214..288 | CDD:278498 | 26/117 (22%) | ||
| Pyr_redox_dim | 388..497 | CDD:280934 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45464300 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||