DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10700 and Trxr-2

DIOPT Version :9

Sequence 1:NP_609942.1 Gene:CG10700 / 35183 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_524216.1 Gene:Trxr-2 / 40475 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster


Alignment Length:430 Identity:79/430 - (18%)
Similarity:128/430 - (29%) Gaps:173/430 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 VVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLALREEQFYKDYGI 199
            ||:|||.:|..|.:.          ...||.:.|.:|                     :.|...:
  Fly    36 VVLGGGSAGLACAKE----------AAGCGARVLCFD---------------------YVKPTPV 69

  Fly   200 EMQLGVSAERLDTNCNTLHCTNGKTFPYDKIY--IATGYSAVTPNI-PG---------VHLKNVK 252
            ..:.|:....::..|......:..:...:.::  :|.|::....|| |.         .|:|:|.
  Fly    70 GTKWGIGGTCVNVGCIPKKLMHQASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVN 134

  Fly   253 VIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQR 317
            .:..: |.|      ||..:.|...::|          ..:.::..||......:....|.:   
  Fly   135 WVTRV-DLR------DKKVEYVNSMATF----------RDSHTIEYVAMPGAEHRQVTSEYV--- 179

  Fly   318 ILKLLEENKVDLRMSSGIIRILGNSRGEVV--AVKL-------LDNSRIPCNLLILGTG-----C 368
                             ::.:.|..|...:  ||:|       ....|.|...|::|.|     |
  Fly   180 -----------------VVAVGGRPRYPDIPGAVELGITSDDIFSYEREPGRTLVVGAGYVGLEC 227

  Fly   369 QCNTDFLQRSGININPNGSVDVNDFLQTKVRNVYVGGDIANAYILGGFPDRVNISHYGLAQYHGR 433
            .|   ||:  |:...|.          ..||::          :|.|| ||              
  Fly   228 AC---FLK--GLGYEPT----------VMVRSI----------VLRGF-DR-------------- 252

  Fly   434 IAALNMSGHIAKL---EAIPFFYTVIFGRAFRSA----------------GYGPFKDVVI----- 474
                .||..:|.:   ..|||..|.|.....|.|                |...| |.|:     
  Fly   253 ----QMSELLAAMMTERGIPFLGTTIPKAVERQADGRLLVRYRNTTTQMDGSDVF-DTVLWAIGR 312

  Fly   475 DGSLEDLQFVAYFFDDYDKVTAVASCGRDPMVAQFAELVS 514
            .|.:|||...|.....:|          |.:|...||..|
  Fly   313 KGLIEDLNLDAAGVKTHD----------DKIVVDAAEATS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 49/304 (16%)
Pyr_redox 273..350 CDD:278498 8/78 (10%)
COG3393 336..>508 CDD:225928 45/209 (22%)
Reductase_C 464..527 CDD:291425 16/72 (22%)
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 12/62 (19%)
TGR 31..515 CDD:273624 79/430 (18%)
NADB_Rossmann <144..239 CDD:304358 21/129 (16%)
Pyr_redox 214..288 CDD:278498 26/117 (22%)
Pyr_redox_dim 388..497 CDD:280934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464300
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.