DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and pyroxd1

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_957057.1 Gene:pyroxd1 ZFINID:ZDB-GENE-040426-1732 Length:490 Species:Danio rerio

Alignment Length:515 Identity:101/516 (20%)
Similarity:177/516 (34%) Gaps:158/516 (31%)


  Fly   122 SMACRNWQDQRHFVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNL 186
            |||.   :.|..||:||||.:|..|.|.:..:              .|.|...::.......|..
Zfish     5 SMAS---EKQVKFVIVGGGIAGVTCAEQIASQ--------------FPSDEVCLLTASPLVKKVT 52

  Fly   187 ALRE-EQFYKDYGIEMQ--------------LGVSAERLDTNCNTLHCTNGKTFPYDKIYIATG- 235
            ..|: .:..:::.||.|              |..:...|....:.|...:|:.|.|.|:.:.:| 
Zfish    53 NFRQVSKTLEEFDIEEQPSRVLEEKYPNLKVLQSAVRLLKAREHLLETEDGQRFFYRKLCLCSGG 117

  Fly   236 ----YSAVTPNIPGVH--------------LKNVKVIRNIGDARSIFKMVDKSTQVV------CL 276
                .|...|::.|:.              .|.:.||.|.|.|..:...|: ..:|:      .:
Zfish   118 RPKLLSKDNPHVLGIRDTDSAQEFQKRLSTAKRIVVIGNGGIALELVYEVE-GCEVIWAVKDKAI 181

  Fly   277 GSSFM----------AVEA----TANLVSRARSVT-LVARQNVPFKSTLGELIGQRILKLLEENK 326
            |::|.          ::||    .:::..|||..| ..|..:....|.||..:|..     ....
Zfish   182 GNTFFDAGAAQFLIPSLEADRREASSVCKRARYTTDSSAAGHSGSSSELGSALGPD-----WHEG 241

  Fly   327 VDLRMSSGIIR------------------ILGNSRGEVVA--------VKLLDNSRIPCNLLILG 365
            ::||.:...:|                  :|.:..|...|        |:|.:.....|:.::..
Zfish   242 IELRGAKQSVRGVHIEYECEVEQIYTQQELLQSEHGTKTAELGVWPAYVQLTNGKIYGCDFIVSA 306

  Fly   366 TGCQCNTD-FLQRSGININPNGSVDVNDFLQTKVRNVYVGGDIANAYILGGFPDRV--NISHYGL 427
            ||...||| ||..:..::..:..:.|:|.::|...:|:..||:.:|   |..|..:  .:..:..
Zfish   307 TGVVPNTDPFLPGNNFDVAADLGLLVDDHMRTSEADVFAAGDVCSA---GWEPSSIWQQMRLWTQ 368

  Fly   428 AQYHGRIAALNMS-----------------GHIAKLEAIPFFYTVIFGRAFRSAGYGPFKDVVID 475
            |:..|..||..|:                 .||.|.    |.|.|:....|.:.|.|        
Zfish   369 ARQMGWYAARCMAADVLDEPIELDFCFELFSHITKF----FNYKVVLLGKFNAQGLG-------- 421

  Fly   476 GSLEDLQFVAYFFDDYDKVTAVASCGR----------------DPMVAQFAELVSQGKEL 519
               :|.:.:.......:.|..|.|.||                :.::....:|...|:||
Zfish   422 ---QDHELLVRCTKGQEYVKVVLSGGRMVGAVLIGETDLEETFENLILNQMDLTRYGEEL 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 70/361 (19%)
Pyr_redox 273..350 CDD:278498 21/124 (17%)
COG3393 336..>508 CDD:225928 43/234 (18%)
Reductase_C 464..527 CDD:291425 12/73 (16%)
pyroxd1NP_957057.1 Pyr_redox_2 13..373 CDD:285266 74/383 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.