DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and aifm1

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_005165182.1 Gene:aifm1 ZFINID:ZDB-GENE-030826-11 Length:748 Species:Danio rerio

Alignment Length:388 Identity:81/389 (21%)
Similarity:157/389 (40%) Gaps:62/389 (16%)


  Fly   134 FVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLL-----------------NT 181
            ::::|||.:......::|......|:.::..|..|||.|..:...|                 |.
Zfish   271 YLLIGGGTASFAAARSIRARDPGARVLIITEESDLPYMRPPLSKELWFSDDPKVTESLRFKQWNG 335

  Fly   182 YTKNLALREEQFY---------KDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYS 237
            ..:::..:...||         ::.|:.:........:|...|.:..::|....|:|..||||  
Zfish   336 KERSIYFQPPSFYVSPADLAKVENGGVAVLTDSKVVHMDVRGNKVKLSDGSEISYEKCLIATG-- 398

  Fly   238 AVTPNIPGVH------LKNVKVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSRARSV 296
            .|..|:..:.      :|...:.|.|.|.||:.|:..:...:..:|..|:..|....|..|:...
Zfish   399 GVPRNLQVIDRAGEEVIKRTTLFRKIEDFRSLEKISREVKSITIIGGGFLGSELACALGRRSADP 463

  Fly   297 TLVARQNVPFKSTLGELIGQRILKLLEE--NKVDLRMSSGIIRILGNSRGEVVAVKLLDNSRIPC 359
            .|...|..|.|..:|:::.:.:.....|  .|..:.:.:..:......:.:.:.:||.|...:..
Zfish   464 GLEVMQLFPEKGNMGKVLPEYLSNWTTEKVRKEGVNVITDAVVKNVTYKNDKLEIKLKDGRLVKT 528

  Fly   360 NLLILGTGCQCNTDFLQRSGININPN-GSVDVNDFLQTKVRNVYVGGDIANAY--ILGGFPDRVN 421
            :.::...|.:.:.:..:.:|:.::.: |...||..||.: .|::|.||.|..|  .||    |..
Zfish   529 DHIVAAVGLEPSVELAKSAGLEVDSDFGGYRVNAELQAR-SNIWVAGDAACFYDIKLG----RRR 588

  Fly   422 ISHYGLAQYHGRIAALNMSGHIAKLEAIPFFYTVIFGRAFRSAGYGPFKDV------VIDGSL 478
            :.|:..|...||:|..||:|     ...|:::..:|.     :..||  ||      ::|.||
Zfish   589 VEHHDHAVVSGRLAGENMTG-----ANKPYWHQSMFW-----SDLGP--DVGYEAIGIVDSSL 639

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 62/316 (20%)
Pyr_redox 273..350 CDD:278498 12/79 (15%)
COG3393 336..>508 CDD:225928 36/153 (24%)
Reductase_C 464..527 CDD:291425 7/22 (32%)
aifm1XP_005165182.1 AIF-MLS <56..203 CDD:291623
Pyr_redox_2 274..584 CDD:285266 61/313 (19%)
Pyr_redox 439..523 CDD:278498 15/84 (18%)
AIF_C 602..728 CDD:291391 13/51 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.