DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and txnrd3

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_898895.2 Gene:txnrd3 ZFINID:ZDB-GENE-030327-3 Length:602 Species:Danio rerio

Alignment Length:468 Identity:96/469 (20%)
Similarity:161/469 (34%) Gaps:125/469 (27%)


  Fly   135 VVVGGGPSGAVC---VETLRQE----------------GFTGRLTLV-CGEKHLPYDRTRIMNLL 179
            :|:|||..|..|   ..||.::                |..|....| |..|.|.:...    ||
Zfish   119 IVIGGGSGGLACSKEAATLGKKVMVLDYVVPTPQGTAWGLGGTCVNVGCIPKKLMHQTA----LL 179

  Fly   180 NTYTKNLALREEQF--------------YKDYGIEMQLGVSAERLDTNCN------------TLH 218
            .|..::......:|              ..:|...:..|......|.|.|            .:.
Zfish   180 GTAMEDARKFGWEFAEQVTHNWETMKTAVNNYIGSLNWGYRVSLRDKNVNYVNAYAEFVEPHKIK 244

  Fly   219 CTN--GKTFPYD--KIYIATGYSAVTPNIPGVHLKNVKVIRNIGDARSIFKMVDKSTQVVCLGSS 279
            .||  ||...|.  :..:|||.......|||.  |...:..:     .:|.:.....:.:.:|:|
Zfish   245 ATNKRGKETFYTAAQFVLATGERPRYLGIPGD--KEFCITSD-----DLFSLPYCPGKTLVVGAS 302

  Fly   280 FMAVEATANLVSRARSVTLVARQ------NVPFKSTLGELI---GQRILKLLEENKVDLRMSSGI 335
            ::|:|....|......||::.|.      :.......||.:   |.:.|:.....|:: ::.:| 
Zfish   303 YVALECGGFLAGLGLDVTIMVRSILLRGFDQDMADRAGEYMETHGVKFLRKFVPTKIE-QLEAG- 365

  Fly   336 IRILGNSRGEV-VAVKLLDNSRI---PCNLLILGTGCQCNTD--FLQRSGININ-PNGSVDVNDF 393
                  :.|.: |..|..::..:   ..|.:::..|....|.  .|.::|:.|| .||.|.|||.
Zfish   366 ------TPGRIKVTAKSTESEEVFEGEYNTVLIAVGRDACTGKIGLDKAGVKINEKNGKVPVNDE 424

  Fly   394 LQTKVRNVYVGGDI------------------ANAYILGGFP--DRVNI-------SHYGLAQYH 431
            .||.|.::|..|||                  |.....|...  |.||:       ..||... |
Zfish   425 EQTNVPHIYAIGDILEGKWELTPVAIQAGKLLARRLYAGATMKCDYVNVPTTVFTPMEYGSCG-H 488

  Fly   432 GRIAALNMSGHIAKLEAIPFFYTVIFGRAFRSAGYGPFK--DVVIDGSLEDLQFVAYFF--DDYD 492
            ....|:.|.|.    |.:..::::.:...|...|....|  ..:|...|::|:.:.:.:  .:..
Zfish   489 PEEKAIQMYGQ----ENLEVYHSLFWPLEFTVPGRDNNKCYAKIICNKLDNLRVIGFHYLGPNAG 549

  Fly   493 KVT----AVASCG 501
            :||    |...||
Zfish   550 EVTQGFGAAMKCG 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 74/363 (20%)
Pyr_redox 273..350 CDD:278498 16/87 (18%)
COG3393 336..>508 CDD:225928 46/209 (22%)
Reductase_C 464..527 CDD:291425 10/47 (21%)
txnrd3NP_898895.2 GRX_GRXh_1_2_like 25..106 CDD:239511
TGR 114..602 CDD:273624 96/469 (20%)
NADB_Rossmann 114..>160 CDD:304358 9/41 (22%)
Pyr_redox 295..371 CDD:278498 15/84 (18%)
Pyr_redox_dim 474..584 CDD:280934 18/95 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80273339
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.