DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and aif1

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001342910.1 Gene:aif1 PomBaseID:SPAC26F1.14c Length:611 Species:Schizosaccharomyces pombe

Alignment Length:535 Identity:162/536 (30%)
Similarity:267/536 (50%) Gaps:63/536 (12%)


  Fly    34 ILLVKQSGILRAVGAMCPHRGAPLAKGVL-SRNRVRCPWHGVCFNLETGDIENFPGLDSLPCHRV 97
            :|||:......|....|.|.||||||||: |...:.|||||.|||..|||:|:.|.:.:|....|
pombe    81 VLLVRARNTYFATAGKCSHYGAPLAKGVVTSDGHIVCPWHGACFNAATGDVEDTPAIAALRTFPV 145

  Fly    98 NVDSRGQVLVQVKRSYLLRHARIKSMACRNWQDQR----------------HFVVVGGGPSGAVC 146
            ..:..|.:.::|:.......:.::...|  |:::.                |..::|||...:|.
pombe   146 TEEGDGSLW
IEVEDKNDNGASVLQPEGC--WRNKATEVYNKGSVETEVTAPHVCIIGGGKGASVA 208

  Fly   147 VETLRQEGFTGRLTLVCGEKHLPYDRTRI-MNLLNTYTKNLALREEQFYKDYGIEMQLGVSAERL 210
            .|.||::.|.|::|:...|..:||||.:: .:||:..:| ||||.:::|.|..|.........::
pombe   209 AEYLREKNFKGKITIFTREDEVPYDRPKLSKSLLHDISK-LALRSKEYYDDLDISFHFNTDVTKI 272

  Fly   211 DTNCNTLHCTNGK--TFPYDKIYIATGYSAVTPN---IPGVHLKNVKVIRNIGDARSIFKMV--- 267
            |.....::|.:.:  |..|.|:.:|||..   ||   |||:..|||.::|:|.||..:..:.   
pombe   273 DLAEKKIYCGSDEKPTESYTKLILATGGE---PNKLPIPGLDSKNVYLLRSIADASKLAAVTTEA 334

  Fly   268 -DKSTQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQRILKLLEENKVDLRM 331
             ||. .:|.:||||:.:|..  :|.:..:|:::..:::||:..:|:.:|..:..|.|:|.:...:
pombe   335 GDKK-NIVIIGSSFIGLELA--VVLKDHNVSVIGMESIPFEKVMGKEVGTALKALHEQNGIAFYL 396

  Fly   332 SSGI--IRILGNSRGEVVAVKLLDNSRIPCNLLILGTGCQCNTDFLQRSGININPNGSVDVNDFL 394
            .:.|  ::...|...:...:.|.|...||.:::||..|.:.|..:| .:.:::..:|.|.|::..
pombe   397 ENSIKEVKTSSNDSSKAEHIVLKDGQSIPADVVILAAGVKPNLRYL-GNAVSLEKDGGVKVDEHC 460

  Fly   395 QT-KVRNVYVGGDIANAYILG----GFPDRVNISHYGLAQYHGRIAA-----LNMSGHIAKLEAI 449
            :. ...:||..||||:|...|    |......|.|:.:|...||:||     .|.:|:..| ...
pombe   461 RVLGAEDVYAVGDIAHAPFAGLPSSGEKSHTRIEHWDVAGNLGRVAADHILFGNKAGYTTK-SFT 524

  Fly   450 PFFYTVIFGRAFRSAGYGP---FKDVVIDGSLEDLQFVAYFFDDYDKVTAVASCGRDPMVAQFAE 511
            |:|::. .|:..|..|...   |.||||.|||.|.:| |.||...:||..|.|..:||:|:|.|.
pombe   525 PYFWSA-QGKQLRYCGNNAAEGFDDVVIQGSLSDYKF-ACFFTKGEKVVGVCSIMKDPVVSQCAR 587

  Fly   512 LV--------SQGKE 518
            |.        ||.||
pombe   588 LFIKDAMPSKSQLKE 602

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 31/73 (42%)
Pyr_redox_2 135..414 CDD:285266 83/292 (28%)
Pyr_redox 273..350 CDD:278498 17/79 (22%)
COG3393 336..>508 CDD:225928 57/185 (31%)
Reductase_C 464..527 CDD:291425 28/67 (42%)
aif1NP_001342910.1 Rieske_AIFL_N 58..154 CDD:239560 31/73 (42%)
Pyr_redox_2 194..499 CDD:311792 88/313 (28%)
Reductase_C 526..>576 CDD:317198 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 271 1.000 Inparanoid score I695
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002264
OrthoInspector 1 1.000 T631629
orthoMCL 1 0.900 OOG5_126784
Panther 1 1.100 O PTHR43557
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R33
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.