DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and AIF

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_722765.2 Gene:AIF FlyBaseID:FBgn0031392 Length:739 Species:Drosophila melanogaster

Alignment Length:407 Identity:87/408 (21%)
Similarity:162/408 (40%) Gaps:97/408 (24%)


  Fly   134 FVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKN------------- 185
            ::::|||.:.......::....|.::.::..|...||.|..:...| .||.|             
  Fly   257 YLIIGGGTAAFSAFRAIKSNDATAKVLMISNEFRKPYMRPPLSKEL-WYTPNPNEDPIKDYRFKQ 320

  Fly   186 -------LALREEQFYKD---------YGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIAT 234
                   |....::|:.|         .||.:..|.|.:::|.....:...:|....||:..|||
  Fly   321 WTGSERSLFFEPDEFFIDPEDLDDNANGGIAVAQGFSVKKVDAQKRIVTLNDGYEISYDECLIAT 385

  Fly   235 GYSAVTPNIPGVH------LKNVKVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSRA 293
            |  ....|:|.:.      |:.|.|.|...|...:.|:..:...:..:|:.|:..|...:|...:
  Fly   386 G--CAPKNLPMLRDAPPSVLEKVMVYRTPDDFDRLRKLAAEKRSITIVGNGFIGSELACSLAHYS 448

  Fly   294 RSVTLVARQNVPFKSTLGELIGQRILKLLEEN----KV---------DLRMSSGIIRILGNS--- 342
            |                 |..|.::.::.:||    ||         ..:|.:..:.::.|:   
  Fly   449 R-----------------ENNGGKVYQVFQENANMSKVLPNYLSRWTTAKMEAQGVCVIPNASIR 496

  Fly   343 ---RGEV-VAVKLLDNSRIPCNLLILGTGCQCNTDFLQRSGININPN-GSVDVNDFLQTKVRNVY 402
               |.|. :.::|.:...:..:::::..||..|||....|.:.::.: |...||..|:.: ||:|
  Fly   497 SAVRDETNLKLELNNGMTLMSDVVVVCVGCTPNTDLAGPSRLEVDRSLGGFVVNAELEAR-RNLY 560

  Fly   403 VGGDIANAY--ILGGFPDRVNISHYGLAQYHGRIAALNMSGHIAKLEAIPFFYTVIF----GRAF 461
            |.||.:..:  :||    |..:.|:..:...||:|..||:|  ||.   |:.:..:|    |...
  Fly   561 VAGDASCFFDPLLG----RRRVEHHDHSVVSGRLAGENMTG--AKK---PYQHQSMFWSDLGPEI 616

  Fly   462 RSAGYGPFKDVVIDGSL 478
            ...|.|     ::|.||
  Fly   617 GYEGIG-----LVDSSL 628

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 68/337 (20%)
Pyr_redox 273..350 CDD:278498 15/97 (15%)
COG3393 336..>508 CDD:225928 40/158 (25%)
Reductase_C 464..527 CDD:291425 5/16 (31%)
AIFNP_722765.2 Pyr_redox_2 257..573 CDD:285266 67/337 (20%)
Pyr_redox 427..512 CDD:278498 16/102 (16%)
AIF_C 591..720 CDD:291391 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79740436
eggNOG 1 0.900 E1_COG0446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43557
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.