DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and CG4199

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001188537.1 Gene:CG4199 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster

Alignment Length:536 Identity:316/537 (59%)
Similarity:400/537 (74%) Gaps:1/537 (0%)


  Fly     3 ENEYIDPVVV-CHKLEVQENEMRQVDASGIPSILLVKQSGILRAVGAMCPHRGAPLAKGVLSRNR 66
            ::||...|.| |...:::||||:|||......:|||||:..|.||||.|.|.||||..|.|...|
  Fly    50 DSEYTSAVPVDCRVTDLKENEMKQVDFDEDTRVLLVKQNDRLLAVGAKCTHYGAPLQTGALGLGR 114

  Fly    67 VRCPWHGVCFNLETGDIENFPGLDSLPCHRVNVDSRGQVLVQVKRSYLLRHARIKSMACRNWQDQ 131
            |||||||.|||||.||||:|||||||||:||.|.:.|||:::.|||.|:.:.|:|:|..|...||
  Fly   115 VRCPWHGACFNLENGDIEDFPGLDSLPCYRVEVGNEGQVMLRAKRSDLVNNKRLKNMVRRKPDDQ 179

  Fly   132 RHFVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLALREEQFYKD 196
            |.|:||||||||||.|||:|||||||||..||.|.:|||||.:|...:|...:.|..|:|:|||:
  Fly   180 RVFIVVGGGPSGAVAVETIRQEGFTGRLIFVCREDYLPYDRVKISKAMNLEIEQLRFRDEEFYKE 244

  Fly   197 YGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGVHLKNVKVIRNIGDAR 261
            |.||:..||:||:|||....|||:||....|||||:|||.||..|.||||:|:||:.:|.:.|.:
  Fly   245 YDIELWQGVAAEKLDTAQKELHCSNGYVVKYDKIYLATGCSAFRPPIPGVNLENVRTVRELADTK 309

  Fly   262 SIFKMVDKSTQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQRILKLLEENK 326
            :|...:...::||||||||:|:||.|.|||:.:|||:|.|:|||.|:..|..||||:|:|.|:||
  Fly   310 AILASITPESRVVCLGSSFIALEAAAGLVSKVQSVTVVGRENVPLKAAFGAEIGQRVLQLFEDNK 374

  Fly   327 VDLRMSSGIIRILGNSRGEVVAVKLLDNSRIPCNLLILGTGCQCNTDFLQRSGININPNGSVDVN 391
            |.:||.|||..|:||..|:|..|.|:|::|:||:|||||||.:.||.||.:||:.:|.||||||.
  Fly   375 VVMRMESGIAEIVGNEDGKVSEVVLVDDTRLPCDLLILGTGSKLNTQFLAKSGVKVNRNGSVDVT 439

  Fly   392 DFLQTKVRNVYVGGDIANAYILGGFPDRVNISHYGLAQYHGRIAALNMSGHIAKLEAIPFFYTVI 456
            |||::.|.:||||||||||:|.|...|||||.||.|||||||:||:||.|.:.||||:|||:|:|
  Fly   440 DFLESNVPDVYVGGDIANAHIHGLAHDRVNIGHYQLAQYHGRVAAINMCGGVKKLEAVPFFFTLI 504

  Fly   457 FGRAFRSAGYGPFKDVVIDGSLEDLQFVAYFFDDYDKVTAVASCGRDPMVAQFAELVSQGKELCR 521
            ||:..|.||:|.:|||:||||:||.:|||||.::.|.|||||||||||:|||||||:||||.|.|
  Fly   505 FGKGIRYAGHGSYKDVIIDGSMEDFKFVAYFINEADTVTAVASCGRDPIVAQFAELISQGKCLGR 569

  Fly   522 CQIVDPKGRNYWLTKL 537
            .||.||..|..|..||
  Fly   570 GQIEDPATREDWTKKL 585

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 60/97 (62%)
Pyr_redox_2 135..414 CDD:285266 160/279 (57%)
Pyr_redox 273..350 CDD:278498 46/77 (60%)
COG3393 336..>508 CDD:225928 109/172 (63%)
Reductase_C 464..527 CDD:291425 45/63 (71%)
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560 59/95 (62%)
Pyr_redox_2 183..465 CDD:285266 161/282 (57%)
Pyr_redox 320..402 CDD:278498 48/82 (59%)
Reductase_C 505..577 CDD:291425 49/72 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131259569
eggNOG 1 0.900 E1_COG0446
Homologene 1 1.000 H135034
Inparanoid 1 1.050 117 1.000 Inparanoid score I1950
Isobase 1 0.950 0 Normalized mean entropy S3886
OrthoDB 1 1.010 D183405at33208
OrthoFinder 1 1.000 FOG0002264
orthoMCL 1 0.900 OOG5_126784
Panther 1 1.100 P PTHR43557
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R33
109.870

Return to query results.
Submit another query.