DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and Aifm3

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_008767097.1 Gene:Aifm3 RGDID:1306028 Length:608 Species:Rattus norvegicus

Alignment Length:524 Identity:194/525 (37%)
Similarity:302/525 (58%) Gaps:22/525 (4%)


  Fly    12 VCHKLEVQENEMRQVDASGIPSILLVKQSGILRAVGAMCPHRGAPLAKGVLSRNRVRCPWHGVCF 76
            |||..:::..:||:|:. |...:||||.:|...|:|..|||.||||.||||||.||||||||.||
  Rat    72 VCHVKDLENGQMREVEL-GWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACF 135

  Fly    77 NLETGDIENFPGLDSLPCHRVNVDSRGQVLVQVKRSYLLRHARIKSMA-CRN---WQDQRHFVVV 137
            |:.|||:|:|||||||...:|.:: :.:|.|:..:..|....|.|.|| |.:   .....:.::|
  Rat   136 NIGTGDLEDFPGLDSLHKFQVKIE-KEKV
TVRASKQALQLQRRTKVMAKCISPSAGHSSTNVLIV 199

  Fly   138 GGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLALREEQFYKDYGIEMQ 202
            |.|.:|.||.||||||||:.|:.|...::||||||.::...|:...:.||||.::|::.|||||.
  Rat   200 GAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRAKLSKSLDAQPEQLALRPKEFFRAYGIEML 264

  Fly   203 LGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGVHLKNVKVIRNIGDARSIFKMV 267
            .......:|.....:...:|....|.|:.:|.|.|..|....|..::||..||...||..:.::.
  Rat   265 TEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSSPKTLTCKGKDIENVFTIRTPEDANRVLRLA 329

  Fly   268 DKSTQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQRILKLLEENKVDLRMS 332
             :....|.:|:.|:.:|..|.|..:|.||::|..:..||:..|||.:|:.::|:.|.|:|...|.
  Rat   330 -RGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQ 393

  Fly   333 SGIIRILGNSRGEVVAVKLLDNSRIPCNLLILGTGCQCNTDFLQRSGININPNGSVDVNDFLQTK 397
            :.:.. |....|::..|.|..:..:..::.::|.|....|.||::|||.::..|.:.||..:||.
  Rat   394 TEVSE-LRAQEGKLQEVVLKSSKVLRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTN 457

  Fly   398 VRNVYVGGDIANAYILGGFP------DRVNISHYGLAQYHGRIAALNMSGHIAKLEAIPFFYTVI 456
            :..|:..||...      ||      .:|||.|:.:|...||:||.||....|::..:|:.:|.:
  Rat   458 IPGVFAAGDAVT------FPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEINTVPYLWTAM 516

  Fly   457 FGRAFRSAGYGP-FKDVVIDGSLEDLQFVAYFFDDYDKVTAVASCGRDPMVAQFAELVSQGKELC 520
            ||::.|.||||. |.||:|.|.||:|:||| |:...|:|.||||...||:|::.||:::.|:.:.
  Rat   517 FGKSLRYAGYGEGFDDVIIQGDLEELKFVA-FYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIR 580

  Fly   521 RCQI 524
            :.::
  Rat   581 KREV 584

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 51/94 (54%)
Pyr_redox_2 135..414 CDD:285266 89/279 (32%)
Pyr_redox 273..350 CDD:278498 24/77 (31%)
COG3393 336..>508 CDD:225928 64/179 (36%)
Reductase_C 464..527 CDD:291425 28/63 (44%)
Aifm3XP_008767097.1 Rieske_AIFL_N 70..163 CDD:239560 50/93 (54%)
Pyr_redox_2 194..492 CDD:285266 96/306 (31%)
NADB_Rossmann 195..284 CDD:304358 34/89 (38%)
Pyr_redox 333..413 CDD:278498 25/81 (31%)
Reductase_C 511..>561 CDD:291425 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80215580
eggNOG 1 0.900 E1_COG0446
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 366 1.000 Inparanoid score I2065
OMA 1 1.010
OrthoDB 1 1.010 D183405at33208
OrthoFinder 1 1.000 FOG0002264
OrthoInspector 1 1.000 T618407
orthoMCL 1 0.900 OOG5_126784
Panther 1 1.100 O PTHR43557
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.860

Return to query results.
Submit another query.