DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and Pyroxd1

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001004234.1 Gene:Pyroxd1 RGDID:1303253 Length:498 Species:Rattus norvegicus

Alignment Length:368 Identity:70/369 (19%)
Similarity:130/369 (35%) Gaps:108/369 (29%)


  Fly   134 FVVVGGGPSGAVCVETLRQEGFTGRLTLVCGE---------KHLPYDRTRIMNLLNTYTKNLALR 189
            |||||||.:|..|.|.|........:.||...         |.:    ::::...:...:...:.
  Rat    10 FVVVGGGIAGVTCAEQLAINFPAEDILLVTASPVIKAVTNFKQV----SKVLEEFDVEEQPSTML 70

  Fly   190 EEQFYKDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAV-----TPNIPGVHLK 249
            |.:|.....||.  ||...:.|.:|  :...:|:.:.|.|:.:..|....     .|.:.|    
  Rat    71 ENRFPNIKVIES--GVKQLKSDKHC--IFTEDGREYVYKKLCLCAGAKPKLICEGNPYVLG---- 127

  Fly   250 NVKVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVE-----------------ATANLVSRARSVT 297
                ||:...|:...|.:.|:.:::.:|:..:|:|                 |..|....|.:..
  Rat   128 ----IRDTDSAQEFQKQLTKARRIMIVGNGGIALELAYEVEVCEVIWAIKDKAIGNTFFDAGAAE 188

  Fly   298 LVARQNVPFKSTLGELIGQRILKLLEENKVDLRMSS--------------GIIRILG-------- 340
            .:..:.:..||. .:|..:|.:..:||.|.:....|              |.:.:.|        
  Rat   189 FLTSRLLSEKSE-AKLAHKRTIYTVEEAKKETSTKSKADYVGSALGPDWHGGLALKGTEEFSHSI 252

  Fly   341 --NSRGEV-----------------------------------VAVKLLDNSRIPCNLLILGTGC 368
              .::.||                                   |.|:|.:.|...|:.|:..||.
  Rat   253 HIETKCEVKKIYLQEEFKIMKKKSLAFPKDHHKSVTVDKEMWPVYVELTNGSIYGCDFLVSATGV 317

  Fly   369 QCNTD-FLQRSGININPNGSVDVNDFLQTKVRNVYVGGDIANA 410
            ..|.. ||..:..::..:|.:.|::.::|.:.::|..|||..|
  Rat   318 TPNVQPFLHGNDFDLGEDGGLRVDEQMRTSLPDIYAAGDICTA 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 69/368 (19%)
Pyr_redox 273..350 CDD:278498 20/153 (13%)
COG3393 336..>508 CDD:225928 22/122 (18%)
Reductase_C 464..527 CDD:291425
Pyroxd1NP_001004234.1 Pyr_redox_2 <76..381 CDD:285266 54/299 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.