DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and Txnrd3

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001171529.1 Gene:Txnrd3 MGIID:2386711 Length:652 Species:Mus musculus

Alignment Length:577 Identity:116/578 (20%)
Similarity:181/578 (31%) Gaps:215/578 (37%)


  Fly    41 GIL--RAVGAM-------CPHRGAPLAKGVLSR-------------------NRVR------CPW 71
            |:|  |.:||:       .|.|.|.||....||                   |||.      || 
Mouse    23 GVLPNRRLGAVRGGLMSSPPGRRARLASPGTSRPSSEAREELRRRLRDLIEGNRVMIFSKSYCP- 86

  Fly    72 H-----------GVCFN-LETGDIENFPGLDSLPCHRVNVDSRGQVLVQVKRSYLLRHARIKSM- 123
            |           ||.:| ||...:::...:.             :||.::.....:.:..:..: 
Mouse    87 HSTRVKELFSSLGVVYNILELDQVDDGASVQ-------------EVLTEISNQKTVPNIFVNKVH 138

  Fly   124 --AC-RNWQ-------------DQRH---FVVVGGGPSGAVCVETLRQEGFTGRLTLV------- 162
              .| |.:|             |..|   .:::|||..|..|.   ::....|:..:|       
Mouse   139 VGGCDRTFQAHQNGLLQKLLQDDSAHDYDLIIIGGGSGGLSCA---KEAANLGKKVMVLDFVVPS 200

  Fly   163 ----------------CGEKHLPYDRTRIMNLLNTYTKNLALREEQFYKDYGIEMQLGVS----- 206
                            |..|.|.:....:.:.|            |..|.||.|....|.     
Mouse   201 PQGTTWGLGGTCVNVGCIPKKLMHQAALLGHAL------------QDAKKYGWEYNQQVKHNWEA 253

  Fly   207 -AERLDTNCNTLH----------------------------CTNGK---TF-PYDKIYIATGYSA 238
             .|.:.::..:|:                            .||.|   || ...|..||||   
Mouse   254 MTEAIQSHIGSLNWGYRVTLREKGVTYVNSFGEFVDLHKIKATNKKGQETFYTASKFVIATG--- 315

  Fly   239 VTPNIPGVHLKNVKVIRNIGDARSIFKMVDKSTQVVC------LGSSFMAVEATANLVSRARSVT 297
            ..|...|:.          ||........|..:...|      :|:|::.:|....|......||
Mouse   316 ERPRYLGIQ----------GDKEYCITSDDLFSLPYCPGCTLVVGASYVGLECAGFLAGLGLDVT 370

  Fly   298 LVARQNV--PFKSTLGELIGQRILKLLEENKVDLRMS-------------SGIIRILGNSRGEVV 347
            ::.|..:  .|...:.|.:|    ..||:..|..:..             .|.::::..|.....
Mouse   371 VMVRSVLLRGFDQEMAEKVG----SYLEQQGVKFQRKFTPILVQQLEKGLPGKLKVVAKSTEGPE 431

  Fly   348 AVKLLDNSRIPCNLLILGTGCQCNTDFLQRSGININ-PNGSVDVNDFLQTKVRNVYVGGDIANAY 411
            .|:.:.|:    .||.:|.........|::.|:.|| .||.:.|||..||.|.:||..||     
Mouse   432 TVEGIYNT----VLLAIGRDSCTRKIGLEKIGVKINEKNGKIPVNDVEQTNVPHVYAIGD----- 487

  Fly   412 ILGGFPDRVNISHYGLAQYHGRIAALNMSG-HIAKLEAIPFFYTVIFGRAFRSAGYG 467
            ||.|.|:...:     |...|::.|..:.| .:.|.:.|....||     |....||
Mouse   488 ILDGKPELTPV-----AIQAGKLLARRLFGVSLEKCDYINIPTTV-----FTPLEYG 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 24/111 (22%)
Pyr_redox_2 135..414 CDD:285266 73/362 (20%)
Pyr_redox 273..350 CDD:278498 17/98 (17%)
COG3393 336..>508 CDD:225928 37/135 (27%)
Reductase_C 464..527 CDD:291425 2/5 (40%)
Txnrd3NP_001171529.1 GRX_GRXh_1_2_like 76..157 CDD:239511 15/95 (16%)
TGR 164..652 CDD:273624 87/423 (21%)
Pyr_redox 347..421 CDD:278498 14/78 (18%)
Pyr_redox_dim 524..634 CDD:280934 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80282618
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.