DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and Y9C9A.16

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001263749.1 Gene:Y9C9A.16 WormBaseID:WBGene00021183 Length:422 Species:Caenorhabditis elegans

Alignment Length:338 Identity:74/339 (22%)
Similarity:134/339 (40%) Gaps:96/339 (28%)


  Fly   132 RHF--VVVGGG--------------PSGAV-CVETLR----QEGFT----GRLTLVCGEKH---- 167
            :||  :|||||              |||:: .:|.|.    |.|||    |.:||....|.    
 Worm    10 KHFKLLVVGGGAGGLGIASKFTRKLPSGSLGIIEPLEDHYYQPGFTLVGGGLMTLDSNRKKQVNL 74

  Fly   168 LPYDRTRIMNLLNTYTKNLALREEQFYKDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYI 232
            :|...|.|.:.:.|:                            :.:.||:....|:...|:.:.|
 Worm    75 IPKGATWIQDKVETF----------------------------NPSQNTVVLRGGEEISYEYMVI 111

  Fly   233 ATGY--------SAVTP-NIPGV-------HL-KNVKVIRNIGDARSIFKMVDKSTQVVCLGSSF 280
            |.|.        .||.. ..|||       |: |:.:.:.|.....:|:..  .:|.:.|.|:..
 Worm   112 AMGIHLRFDMIKGAVEALETPGVCSNYSPFHVQKHYQEVMNFQKGNAIYTF--PNTPIKCAGAPQ 174

  Fly   281 MAVEATANLVSRARSVTLVARQNVPFKSTLGELIG-----QRILKLLEENKVDLRMSSGIIRILG 340
            .|...|.::: |.|.|.  .:.::.:.::|.::.|     :.:.|:.:|..::::....:|.::.
 Worm   175 KACYITDSIL-RQRGVR--DKAHMIYATSLSKIFGVDHYVKALEKVAQEKTIEVKTKRNLIEVVT 236

  Fly   341 NSRGEVVAVKLLDNSR-------IPCNLLILGTGCQCNTDFLQRSGININPNGSVDVN-DFLQTK 397
            |::..:..: |.|:|:       |..:||.:...|......  ||....:..|.:||: ..||:|
 Worm   237 NNKKAIFEL-LGDDSKPTGVTEEIEFSLLHISPPCTAPEPL--RSSHFADKTGFMDVDPQTLQSK 298

  Fly   398 -VRNVYVGGDIAN 409
             ..||:..||..|
 Worm   299 NYPNVFGVGDCMN 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 72/334 (22%)
Pyr_redox 273..350 CDD:278498 13/82 (16%)
COG3393 336..>508 CDD:225928 22/84 (26%)
Reductase_C 464..527 CDD:291425
Y9C9A.16NP_001263749.1 FadH2 21..>355 CDD:223523 67/328 (20%)
NADB_Rossmann <47..186 CDD:304358 34/170 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.