DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and F20D6.11

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_505112.1 Gene:F20D6.11 WormBaseID:WBGene00017640 Length:549 Species:Caenorhabditis elegans

Alignment Length:490 Identity:147/491 (30%)
Similarity:250/491 (51%) Gaps:9/491 (2%)


  Fly    34 ILLVKQSGILRAVGAMCPHRGAPLAKGVLSRNRVRCPWHGVCFNLETGDIENFPGLDSLPCHRVN 98
            :|::...|.:.|:..:|.|....|..|..::.|:|||.||.|||:.:||||::||.|||..:.|.
 Worm    47 VLVINDEGRIYAINGLCSHYNFSLENGTYAKGRIRCPLHGACFNVRSGDIEDYPGFDSLHSYVVT 111

  Fly    99 VDSRGQVLVQVKRSYLLRHARIKSMACRNWQDQRHFVVVGGGPSGAVCVETLRQEGFTGRLTLVC 163
            |:. |.::::.....|....||:.:......:.|..|::|||.:.|..:|..|..|....:.::.
 Worm   112 VND-GNLI
IKTTEKKLGSDRRIRHLPKMKQCNDRPVVIIGGGVATATFIEHSRLNGLITPILVIS 175

  Fly   164 GEKHLPYDRTRIMNLLNTYTKNLALR-EEQFYKDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPY 227
            .|...||||..:........:::.|| ::.||::..::..|..|...::.....:..:||:|..|
 Worm   176 EESLPPYDRVLLSKKPAATGEDIRLRKDDAFYEERNVKFLLKTSVIAVNHKSREVSLSNGETVVY 240

  Fly   228 DKIYIATGYSAVTPNIPGVHLKNVKVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSR 292
            .|:.||||.:.....:||..|||:..:|.:.:| :|...:.....|||:||||:.:|..:.|..:
 Worm   241 SKLIIATGGNVRKLQVPGSDLKNICYLRKVEEA-NIISNLHPGKHVVCVGSSFIGMEVASALAEK 304

  Fly   293 ARSVTLVARQNVPFKSTLGELIGQRILKLLEENKVDLRMSSGIIRILGNSRGEVVAVKLLDNSRI 357
            |.|||:::....|. ...|..||:.|....||..|...:::.::.:.||.:|||..|.|.:...:
 Worm   305 AASVTVISNTPEPL-PVFGSDIGKGIRLKFEEKGVKFELAANVVALRGNDQGEVSKVILENGKEL 368

  Fly   358 PCNLLILGTGCQCNTDFLQRSGININPNGSVDVNDFLQTKVRNVYVGGDIANAYILGGFPDRVNI 422
            ..:||:.|.|....|.||:.|||.::..|.::|::..:|.:..::..||:..|.:.....|.:||
 Worm   369 DVDLLVCGIGVTPATKFLEGSGIKLDNRGFIEVDEKFRTNISYIFAMGDVVTAPLPLWDIDSINI 433

  Fly   423 SHYGLAQYHGRIAALNMSGHIAKLEAIPFFYTVI---FGRAFRSAGYGPFKDVVIDGSLEDLQFV 484
            .|:..||.||:.....:.|.......:|:|:|:.   ||..|.....|..|:.. :|..|...|:
 Worm   434 QHFQTAQAHGQHLGYTIVGKPQPGPIVPYFWTLFFFAFGLKFSGCNQGSTKEYT-NGDPETGTFI 497

  Fly   485 AYFFDDYDKVTAVASCGRDPMVAQFAELVSQGKEL 519
            .||... |||.|||:.|...:.:||||:..:|.|:
 Worm   498 RYFLKK-DKVVAVAAGGPSSVASQFAEIFKKGIEV 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 28/72 (39%)
Pyr_redox_2 135..414 CDD:285266 80/280 (29%)
Pyr_redox 273..350 CDD:278498 27/77 (35%)
COG3393 336..>508 CDD:225928 52/175 (30%)
Reductase_C 464..527 CDD:291425 20/57 (35%)
F20D6.11NP_505112.1 Rieske_AIFL_N 29..118 CDD:239560 28/72 (39%)
Pyr_redox_2 146..443 CDD:285266 87/299 (29%)
Pyr_redox 284..365 CDD:278498 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131259634
eggNOG 1 0.900 E1_COG0446
Hieranoid 1 1.000
Homologene 1 1.000 H135034
Inparanoid 1 1.050 302 1.000 Inparanoid score I1594
Isobase 1 0.950 0 Normalized mean entropy S3886
OMA 1 1.010
OrthoDB 1 1.010 D183405at33208
OrthoFinder 1 1.000 FOG0002264
OrthoInspector 1 1.000 T375199
orthoMCL 1 0.900 OOG5_126784
Panther 1 1.100 O PTHR43557
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R33
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.