DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and sqrd-1

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001255798.1 Gene:sqrd-1 WormBaseID:WBGene00008538 Length:471 Species:Caenorhabditis elegans

Alignment Length:357 Identity:86/358 (24%)
Similarity:143/358 (40%) Gaps:85/358 (24%)


  Fly   132 RHF--VVVGGG--------------PSGAVCVETLR-----QEGFT----GRLTLVCG---EKHL 168
            :||  :|||||              |.|:|.:...|     |.|||    |.::|...   :|.|
 Worm    10 KHFKLLVVGGGAGGLGAASKFARKLPRGSVGIIEPREDHYYQPGFTLVGGGLMSLEANRGKQKDL 74

  Fly   169 -PYDRTRIMNLLNTY--TKN-LALR--EEQFYKDY-----GIEMQLGV---SAERLDTNCNTLHC 219
             |.:.|.|.:.:..:  .|| :.||  :|..| ||     |::::..:   :.|.|||   ...|
 Worm    75 IPKNATWIQDKVQKFEPAKNSVKLRGGDEITY-DYMVIAMGVQLRYDMIKGAKEALDT---PGVC 135

  Fly   220 TNGKTFPYDKIY-----IATGYSAVT-PNIP----GVHLK----NVKVIRNIG---DARSIFKMV 267
            :|...|..:|.|     ...|.:..| ||.|    |...|    ...::|..|   .|..|:...
 Worm   136 SNYSPFYVEKHYKEAMNFKGGNALYTFPNTPIKCAGAPQKACYITDSILRQRGVRDQAHMIYATS 200

  Fly   268 DKSTQ-VVC---LGSSFMAVEATANLVSRARSVTLVARQN---VPFKSTLGELIG-QRILKLLE- 323
            .|..: ::|   :....:..:.:...:.:.:.||:....|   ..:.:....|.| :..||.|| 
 Worm   201 LKRVRFLLCWDIINHGAIGNQKSKKKIRKHQLVTIDCFDNNILKQYNNFFFHLFGIESYLKSLEK 265

  Fly   324 ---ENKVDLRMSSGIIRILGNSRGEVVAVKLLDNSRIP------CNLLILGTGCQCNTDFLQRSG 379
               :.::|:|....:|.:  |:...:...:|||....|      ....:|..|..|:|....|:.
 Worm   266 VARDKEIDVRTRRNLIEV--NTNDRIATFELLDEEAKPTGKTEQIEYSLLHIGPPCSTPEALRNS 328

  Fly   380 ININPNGSVDVN-DFLQT-KVRNVYVGGDIAN 409
            ..::..|.:||: ..||: |..||:..||..|
 Worm   329 AFVDKTGFMDVDGGSLQSKKYPNVFGVGDCMN 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 84/353 (24%)
Pyr_redox 273..350 CDD:278498 14/88 (16%)
COG3393 336..>508 CDD:225928 22/83 (27%)
Reductase_C 464..527 CDD:291425
sqrd-1NP_001255798.1 FadH2 28..>377 CDD:223523 79/340 (23%)
NADB_Rossmann 28..186 CDD:304358 41/162 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.