DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and LOC100498581

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_002936104.1 Gene:LOC100498581 ID: Length:530 Species:Xenopus tropicalis

Alignment Length:523 Identity:207/524 (40%)
Similarity:323/524 (62%) Gaps:20/524 (4%)


  Fly    12 VCHKLEVQENEMRQVDASGIPSILLVKQSGILRAVGAMCPHRGAPLAKGVLSRNRVRCPWHGVCF 76
            :|.:.|:.|.|||:.|..| .:|||||.:|:..|||:.|.|.||||:|||||.||:||||||.||
 Frog    11 LCEESELNEGEMREFDVQG-QTILLVKSNGVFTAVGSKCTHYGAPLSKGVLSGNRIRCPWHGACF 74

  Fly    77 NLETGDIENFPGLDSLPCHRVNVDSRGQVLVQVKRSYLLRHARIKSMACRNWQDQRHFVVVGGGP 141
            |:||||||.:||||||||..|.|:: |:||:...|..|....|:|.|:.:...|:.:.|::|.||
 Frog    75 NIETGDIEEYPGLDSLPCFEVTVEN-GKVL
LNANRKALENPKRVKEMSRQYNGDRTNIVLIGSGP 138

  Fly   142 SGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLALREEQFYKDYGIEMQLGVS 206
            :..||.|||||||:.||:.:|..|||||||||::...:|...|::.||.|.|:..|.||:.....
 Frog   139 AALVCAETLRQEGYKGRIVMVTREKHLPYDRTKLSKAMNVKAKDIYLRSEDFFSSYDIEVWTEKE 203

  Fly   207 AERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGVHLKNVKVIRNIGDARSIFK-MVDKS 270
            ...::|:...:...:..|..|.::.||||........||..|:||.::|:..||.:|.: .:.|:
 Frog   204 VVSINTDEGKVKFRDNSTLQYSQLLIATGSRPRELTCPGSSLQNVFLLRSPDDANAISEAAIGKN 268

  Fly   271 TQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQRILKLLEENKVDLRMSSGI 335
              ||.:|:||:.:|..|.|..:|.||:::.|...||::.||..:|:..:|||:|..|.....:..
 Frog   269 --VVIMGTSFIGMEVAAFLSDKASSVSVIGRSEFPFQAVLGPKVGEVAMKLLQEKGVSFYSRTEA 331

  Fly   336 IRILGNSRGEVVAVKLLDNSRIPCNLLILGTGCQCNTDFLQRSGININPNGSVDVNDFLQTKVRN 400
            ..|.|.: |:|..|.|.:.|::|.::::.|.|....::||:.|.|.::..|::.|:.|::|.|.:
 Frog   332 REIRGEN-GQVREVVLRNGSKLPADVVVAGIGVTPASNFLKGSRIAVDTRGAIFVDQFMRTSVPD 395

  Fly   401 VYVGGDIANAYILGGFP------DRVNISHYGLAQYHGRIAALNMSGHIAKLEAIPFFYTVIFGR 459
            ||..||:.:      ||      .||||.|:.:|..|||||||||......::::|||:|.:.|:
 Frog   396 VYAAGDVVS------FPLSIMEGHRVNIGHWQMAHSHGRIAALNMLNKQVPVDSVPFFWTSLLGK 454

  Fly   460 AFRSAGYGP-FKDVVIDGSLEDLQFVAYFFDDYDKVTAVASCGRDPMVAQFAELVSQGKELCRCQ 523
            :.|..|||. :..:.:.|:||:|:|:|::..| |.|.||:|...||:|||.||::|.|:.:.:.:
 Frog   455 SLRYTGYGEGYTSIELKGNLEELKFLAFYIKD-DYVVAVSSMNYDPVVAQVAEVMSSGRRITKNE 518

  Fly   524 IVD 526
            :::
 Frog   519 VLE 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 57/94 (61%)
Pyr_redox_2 135..414 CDD:285266 96/280 (34%)
Pyr_redox 273..350 CDD:278498 27/77 (35%)
COG3393 336..>508 CDD:225928 65/179 (36%)
Reductase_C 464..527 CDD:291425 24/65 (37%)
LOC100498581XP_002936104.1 Rieske_AIFL_N 10..103 CDD:239560 57/94 (61%)
Pyr_redox_2 129..427 CDD:285266 105/307 (34%)
Pyr_redox 268..349 CDD:278498 28/84 (33%)
Reductase_C 447..515 CDD:291425 28/69 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H135034
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D183405at33208
OrthoFinder 1 1.000 FOG0002264
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.