DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and txnrd1

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001243400.1 Gene:txnrd1 XenbaseID:XB-GENE-956002 Length:653 Species:Xenopus tropicalis

Alignment Length:243 Identity:59/244 (24%)
Similarity:102/244 (42%) Gaps:38/244 (16%)


  Fly   215 NTLHCTNG----KTFPYDKIYIATGYSAVTPNIPGVHLKNVKVIRNIGDARSIFKMVDKSTQVVC 275
            :|:..||.    |.|..:|..||||.......|||.  |...:..:     .:|.:.....:.:.
 Frog   293 HTIKSTNSRGKEKYFTAEKFLIATGERPRYLGIPGD--KEYCITSD-----DLFSLPYCPGKTLV 350

  Fly   276 LGSSFMAVEATANLVSRARSVTLVARQNV--PFKSTLGELIGQRILKLLEENKVDL---RMSSGI 335
            :|:|::|:|....|......||::.|..:  .|...:..:||:    .:||:.|..   .:.:.|
 Frog   351 VGASYVALECAGFLAGLGLDVTVMVRSILLRGFDQQMANMIGE----YMEEHGVKFIKQCVPTKI 411

  Fly   336 IRILGNSRGEV-VAVKLLDNSRI--PCNLLILGTG---CQCNTDFLQRSGININ-PNGSVDVNDF 393
            .:|...:.|.: |..:..|.:..  ..|.::|..|   |..|.. |:..|:.|| ..|.:.|||.
 Frog   412 EQIEAGTPGRLKVTSQASDGAETTEEYNTVLLAIGRDACTRNIG-LEIPGVKINEKTGKIPVNDE 475

  Fly   394 LQTKVRNVYVGGDIANAYILGGFPDRVNISHYGLAQYHGRIAALNMSG 441
            .||.|..:|..||:        ..|::.::  .:|...||:.|..:.|
 Frog   476 EQTNVPYIYAIGDV--------LQDKLELT--PVAIQAGRLLARRLYG 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 53/215 (25%)
Pyr_redox 273..350 CDD:278498 18/83 (22%)
COG3393 336..>508 CDD:225928 29/114 (25%)
Reductase_C 464..527 CDD:291425
txnrd1NP_001243400.1 Thioredoxin_like 73..153 CDD:294274
TGR 166..653 CDD:273624 59/244 (24%)
Pyr_redox 347..423 CDD:278498 17/80 (21%)
Pyr_redox_dim 525..635 CDD:280934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79842036
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.