DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and aifm3

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_012823655.1 Gene:aifm3 XenbaseID:XB-GENE-5763104 Length:618 Species:Xenopus tropicalis

Alignment Length:568 Identity:207/569 (36%)
Similarity:319/569 (56%) Gaps:48/569 (8%)


  Fly     4 NEYIDP--VV---VCHKLEVQENEMRQVDASGIPSILLVKQSGILRAVGAMCPHRGAPLAKGVLS 63
            |.|.:|  ||   |||..:::..:||:||. |....|||||:|...|:|..|||.||||.|||||
 Frog    59 NPYTNPKDVVEASVCHVKDLENGQMREVDL-GCGKALLVKQNGEYYAMGHKCPHYGAPLVKGVLS 122

  Fly    64 RNRVRCPWHGVCFNLETGDIENFPGLDSLPCHRVNVDSRGQVLVQVKRSYLLRHARIKSMA-C-- 125
            :.||||||||.|||:.|||||:|||||:||..:|.:: :.:|.::..:..|....|.|.|| |  
 Frog   123 KGRVRCPWHGACFNIATGDIEDFPGLDALPKFQVKIE-KERVYIRASKQALQSQRRTKVMAKCIA 186

  Fly   126 -RNWQDQ-RHFVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLAL 188
             .|:... .:.:::|.||:|.||.||||||||:.|:.:...||:|||||:::...:::..:.:.|
 Frog   187 LSNYSAAITNILIIGAGPAGLVCAETLRQEGFSDRIVMCTSEKNLPYDRSKLSKSMDSQAEQIFL 251

  Fly   189 REEQFYKDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGVHLKNVKV 253
            |.::|:..|.||:........:||....:...:|....|:|:.||||.:..|....|..|.||..
 Frog   252 RSKEFFHTYDIEVLTESQVVGVDTKNKMVLFKDGFRMEYNKLLIATGNTPKTLKCKGKELDNVFT 316

  Fly   254 IRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQRI 318
            ||...||..:.::. .|...|.:|:||:.:|..|.|..:|.||::|..:|:|||..|||.:|..|
 Frog   317 IRTPEDANKVVRLA-SSKNAVIVGASFLGMEVAAYLCEKAHSVSVVELENIPFKKFLGEKVGLAI 380

  Fly   319 LKLLEENKVDLRMSSGIIRILGNSRGEVVAVKLLDNSRIPCNLLILGTGCQCNTDFLQRSGININ 383
            :|:.|.|:|...|.:.:.. |....|::..|.|.....:..::.::|.|....|.||::||:.::
 Frog   381 MKMFENNRVKFYMQTEVSE-LREQEGKLKEVVLKSGKVLRADVCVIGIGASPTTGFLKQSGVALD 444

  Fly   384 PNGSVDVNDFLQTKVRNVYVGGDIANAYILGGFP------DRVNISHYGLAQYHGRIAALNMSGH 442
            ..|.:.||..:||.:..|:..||:..      ||      .:||:.|:.:|...||||||||...
 Frog   445 SRGYILVNKMMQTNIPGVFAAGDVVT------FPLAFRNNKKVNVPHWQMAHMQGRIAALNMLAQ 503

  Fly   443 IAKLEAIPFFYTVIFGRAFRSAGYGP-FKDVVIDGSLEDLQFVAYF-------FDDY-------- 491
            ..::..:|:.:|.:||::.|.||:|. |.||:|.|.:::|:|||::       |..|        
 Frog   504 GTEINTVPYLWTAMFGKSIRYAGHGDGFDDVIIQGDIDELKFVAFYTRKPKRRFLSYSRMTPCVE 568

  Fly   492 ----DKVTAVASCGRDPMVAQFAELVSQGKELCRCQIVDPKGRNYWLT 535
                |:|.||||...||:|::.||::|.||.:.:..:  ..|...|||
 Frog   569 HWRNDEVIAVASMNYDPIVSKVAEIMSSGKTIRKRDV--ETGDISWLT 614

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 55/99 (56%)
Pyr_redox_2 135..414 CDD:285266 91/279 (33%)
Pyr_redox 273..350 CDD:278498 28/77 (36%)
COG3393 336..>508 CDD:225928 61/198 (31%)
Reductase_C 464..527 CDD:291425 28/83 (34%)
aifm3XP_012823655.1 Rieske_AIFL_N 70..164 CDD:239560 53/96 (55%)
Pyr_redox_2 195..493 CDD:285266 97/306 (32%)
NAD_binding_8 199..>219 CDD:290186 14/20 (70%)
Pyr_redox 334..415 CDD:278498 29/82 (35%)
Reductase_C 512..>582 CDD:291425 24/70 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80211195
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D183405at33208
OrthoFinder 1 1.000 FOG0002264
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.