DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and aifm2

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001135491.1 Gene:aifm2 XenbaseID:XB-GENE-1003376 Length:374 Species:Xenopus tropicalis

Alignment Length:441 Identity:100/442 (23%)
Similarity:177/442 (40%) Gaps:130/442 (29%)


  Fly   135 VVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNL-ALR---EEQF-- 193
            |:||||.:|......|:..|             :|:   .:::|.:.:..|: |||   |..|  
 Frog    14 VIVGGGFAGIAAATQLKSFG-------------IPF---VLVDLKDAFHHNVAALRASVESGFAR 62

  Fly   194 -----YKD-----------YGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPN 242
                 |||           .||.:|    .:|:....|       :...:..:.||||.:...|.
 Frog    63 KTFISYKDTFQDNFIQGKVVGINLQ----TQRVILESN-------EELQFSHLIIATGSNGPFPG 116

  Fly   243 IPGVHLKNV----KVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVS--RARSVTL--- 298
                .:.||    :.|:...|   :.|.:.|:..||.:|.....||..|.:.:  ..:.|||   
 Frog   117 ----KINNVISKDQAIQVYED---LVKEIQKAKHVVVVGGGSAGVEMAAEVKTDYPEKEVTLVHS 174

  Fly   299 -VARQNVPF----KSTLGELIGQRILKLLEENKVDLRMSSGIIRILGNSRGEVVAVKLLDNSR-I 357
             ||..:|..    :.|:.|::..:.::|:...||     :.:.::..|...|...::|..||. :
 Frog   175 KVALADVQLQPKVRRTVKEILLSKGVRLILAQKV-----TNLDQVTSNVAQENTVLQLDKNSEVV 234

  Fly   358 PCNLLILGTGCQ-CNTDFLQRSGININPNGSVDVNDFLQTKVR-NVYVGGDIANAYILGGFPDRV 420
            .|:|::..||.: .::.:....|..:..:|::.|||:||.:.. |||..||.  |||     :..
 Frog   235 TCDLVLCCTGYKISSSSYSSAFGDKLAEDGALIVNDYLQVQGHANVYAVGDC--AYI-----NEP 292

  Fly   421 NISHYGLAQYHGRIAALNMSGHIAKLEAIPFFYTVIFGRAFRSAGYGPFKDVVIDGSLEDLQFVA 485
            .:::|  |..|.|:||.|:...             :.|::.::  |.|       |:|       
 Frog   293 KMAYY--AGIHARVAATNVRNS-------------LIGKSLKT--YKP-------GAL------- 326

  Fly   486 YFFDDYDKVTAVASCGRDPMVAQFAELVSQGKELCRCQIVDPKGRNYWLTK 536
                     :.:.|.||:..|.||     .|..|.|..:...|.|:.:::|
 Frog   327 ---------SMLLSMGRNDGVGQF-----NGCYLGRFFVTMAKSRDIFVSK 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 76/318 (24%)
Pyr_redox 273..350 CDD:278498 19/87 (22%)
COG3393 336..>508 CDD:225928 40/175 (23%)
Reductase_C 464..527 CDD:291425 13/63 (21%)
aifm2NP_001135491.1 Pyr_redox_2 15..298 CDD:285266 76/331 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.