DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and aifm3

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001121885.1 Gene:aifm3 ID: Length:599 Species:Danio rerio

Alignment Length:545 Identity:204/546 (37%)
Similarity:317/546 (58%) Gaps:26/546 (5%)


  Fly     2 EENEYIDPVVVCHKLEVQENEMRQVDASGIPSILLVKQSGILRAVGAMCPHRGAPLAKGVLSRNR 66
            :..:||: ..|||..:::..:||:||. |....||:|:.|...|:|..|||.||||.|||||:..
Zfish    63 KNRDYIE-ASVCHIKDLENGQMREVDL-GAGRALLIKEHGEFFAMGHKCPHYGAPLVKGVLSKGH 125

  Fly    67 VRCPWHGVCFNLETGDIENFPGLDSLPCHRVNVDSRGQVLVQVKRSYLLRHARIKSMA-C----R 126
            |||||||.|||:.|||||:||||||||..:|.|: :.:|:::..:..|....|.|.|: |    .
Zfish   126 VRCPWHGACFNIATGDIEDFPGLDSLPTFQVRVE-KEKVIIRANKQALQTQRRSKVMSKCSAVIN 189

  Fly   127 NWQDQRHFVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLALREE 191
            :.....|.:::|.||:|.||.|||||||||.|:.:...:|||||||.::...|.:..:.|.||..
Zfish   190 SSTGFSHVLIIGSGPAGLVCAETLRQEGFTDRIVICTTDKHLPYDRPKLSKSLESTAEQLQLRSS 254

  Fly   192 QFYKDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVTPNIPGVHLKNVKVIRN 256
            .|::.:.||:.|......:|...:|:...:|....|.|::||||......:..|..:.||..:|.
Zfish   255 DFFQMHDIEVLLEKEVVSVDVKTHTVTFRDGFKMEYRKLFIATGSRPKPLSYKGKDVGNVFHLRT 319

  Fly   257 IGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQRILKL 321
            ..||.||..:. .|...|.:|:||:.:|..|.|..:|.||:::..:.|||:..|||.:|:.::||
Zfish   320 PEDANSIVTLA-SSKNAVIIGTSFIGMEVAAALTDKAHSVSVIGIEAVPFRKALGEKVGKALMKL 383

  Fly   322 LEENKVDLRMSSGIIRILGNSRGEVVAVKLLDNSRIPCNLLILGTGCQCNTDFLQRSGININPNG 386
            .|.|:|...|.:.:..:.|:: |::..|.|.....:..::.::|.|....|.||::||::|:..|
Zfish   384 FESNRVKFYMLNEVWEMRGHN-GQLKEVVLKSGKVLRADVCVIGIGSSPATAFLKQSGVHIDSKG 447

  Fly   387 SVDVNDFLQTKVRNVYVGGDIANAYILGGFP------DRVNISHYGLAQYHGRIAALNMSGHIAK 445
            .:.||..:||.:..|:.|||:..      ||      .:|||.|:.:|..|||:|||.:.|..:.
Zfish   448 FIPVNKTMQTNIDGVFAGGDVVT------FPLGLRSNKKVNIPHWQMAHVHGRLAALGIMGKASD 506

  Fly   446 LEAIPFFYTVIFGRAFRSAGYGP-FKDVVIDGSLEDLQFVAYFFDDYDKVTAVASCGRDPMVAQF 509
            ::.:|:|:|.:||::.|.||||. |.||||.|.|::|:||| |:...::|.||||...||:|::.
Zfish   507 IKTVPYFWTAMFGKSIRYAGYGDGFDDVVIQGDLDELKFVA-FYTKSEEVVAVASMNYDPIVSRV 570

  Fly   510 AELVSQGKELCRCQIVDPKGRNYWL 534
            ||:...||.:.:..:  ..|...||
Zfish   571 AEVFGSGKTIRKRDV--ETGDMSWL 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560 52/96 (54%)
Pyr_redox_2 135..414 CDD:285266 93/279 (33%)
Pyr_redox 273..350 CDD:278498 26/77 (34%)
COG3393 336..>508 CDD:225928 65/179 (36%)
Reductase_C 464..527 CDD:291425 28/64 (44%)
aifm3NP_001121885.1 Rieske_AIFL_N 70..164 CDD:239560 52/96 (54%)
Pyr_redox_2 196..493 CDD:285266 102/305 (33%)
NAD_binding_8 199..>218 CDD:290186 13/19 (68%)
Pyr_redox 334..415 CDD:278498 27/82 (33%)
Reductase_C 512..>562 CDD:291425 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80188988
eggNOG 1 0.900 E1_COG0446
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 396 1.000 Inparanoid score I1873
OMA 1 1.010
OrthoDB 1 1.010 D183405at33208
OrthoFinder 1 1.000 FOG0002264
OrthoInspector 1 1.000 T128754
orthoMCL 1 0.900 OOG5_126784
Panther 1 1.100 O PTHR43557
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R33
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.