DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10700 and pyroxd1

Sequence 1:NP_609942.1 Gene:CG10700 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001120558.1 Gene:pyroxd1 XenbaseID:XB-GENE-5873721 Length:494 Species:Xenopus tropicalis

Alignment Length:453 Identity:89/454 (20%)
Similarity:154/454 (34%) Gaps:146/454 (32%)


  Fly   134 FVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNL--LNTYTKNLALREEQFYKD 196
            |||||||.:|..|.|.|..:              .|.||..::..  |...|.||. :..:..:.
 Frog    14 FVVVGGGIAGVTCAEELAAQ--------------FPSDRVYLLTASPLIKATTNLK-QVSRTLEA 63

  Fly   197 YGIEMQLGVSAERLDTNCNTLHCT--------------NGKTFPYDKIYIATGYSAV-----TPN 242
            :.:|.|.|.:.|....|.:.:...              :|..:.|:|:.:..|..|.     .|.
 Frog    64 FDVEEQEGTALEGRYPNISVVQSAVRELRSQEQEVVTEDGARYRYNKLCLCAGAKAKIIAGGNPY 128

  Fly   243 IPGVHLKNVKVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVE-----------------ATANLV 290
            :.|        ||:...||...:.:..:.:||.:|:..:|:|                 |..|..
 Frog   129 VLG--------IRDTDSAREFQRHLSSARRVVIVGNGGIALELVYELEGCQAIWAIRDGAIGNTF 185

  Fly   291 SRARSVTLVARQ--------NVPFKST--------------LGELIG------------------ 315
            ..|.:...:..|        .:|.:.|              :|..:|                  
 Frog   186 FDAGAAQFLLPQLGADKPPAPLPCRRTKYTTEPPLGGGGGSVGSALGPDWHEGLNLKATGAFSHR 250

  Fly   316 ---------QRILKLLEENKVDLRMSSGIIRILGNSRGE-----VVAVKLLDNSRIPCNLLILGT 366
                     :||  ||.|.:..|.:::  :...|.|...     .|.|:|.:.....|:.::..|
 Frog   251 VHIEAQCEVRRI--LLREEREGLNITA--LPFPGESDSAPSTDWPVYVQLTNGKTYGCDFIVSAT 311

  Fly   367 GCQCNTD-FLQRSGININPNGSVDVNDFLQTKVRNVYVGGDIANAYILGGFPD------RVNISH 424
            |...|.: |:..:..::..:|.:.|||.::|.|||:|..|||..|   ...|.      |:....
 Frog   312 GVVPNIEPFVTGNQFDVAEDGGLRVNDHMETSVRNIYAAGDICTA---SWEPSALWQQMRLWTQA 373

  Fly   425 YGLAQYHGRIAA-------------LNMSGHIAKLEAIPFFYTVIFGRAFRSAGYGPFKDVVI 474
            ..:..|.|:..|             ..:..|:.|.    |.|.||....:.:.|.|...::::
 Frog   374 RQMGWYAGKCMAADFLQQPIEMDFCFELFAHVTKF----FNYKVILLGKYNAQGLGSDHELLL 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 75/372 (20%)
Pyr_redox 273..350 CDD:278498 23/148 (16%)
COG3393 336..>508 CDD:225928 36/165 (22%)
Reductase_C 464..527 CDD:291425 2/12 (17%)
pyroxd1NP_001120558.1 Pyr_redox_2 <85..377 CDD:285266 55/307 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.