DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10495 and AT5G47970

DIOPT Version :8

Sequence 1:NP_609939.1 Gene:CG10495 / 35179 FlyBaseID:FBgn0032750 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001078731.1 Gene:AT5G47970 / 834848 AraportID:AT5G47970 Length:387 Species:Arabidopsis thaliana

Alignment Length:249 Identity:59/250 (24%)
Similarity:107/250 (43%) Gaps:26/250 (10%)


  Fly    17 AEAQSDFVRVSAPMVRYSKLEFRRLVRL-NGVQLAFTPMMISDSINNSEKARQNEFSTGADDQPL 80
            :||.|..:...|||:.::...:|.|.|| ......:|.|:.:::|...|....:..:...|..|:
plant     4 SEAYSPPLFSIAPMMGWTDNHYRTLARLITKHAWLYTEMLAAETIVYQEDNLDSFLAFSPDQHPI 68

  Fly    81 IAQFAAKDPTEFVTSAQLIYPYV-DGIDLNCGCPQSWAMAKG-YGCGMLRQPELVHQVVQEVRRT 143
            :.|...::......:.:|...|. |.|:.|||||......:| :|..::..|:.|.:.:..:...
plant    69 VLQIGGRNLENLAKATRLANAYAYDEINFNCGCPSPKVSGRGCFGALLMLDPKFVGEAMSVIAAN 133

  Fly   144 LPGDFSVSVKMRL-LGGEESLQRTIDLARQLESAGVT--FL------TLHGRTPAQKHSKDTLDI 199
            .  :.:|:||.|: :...:|.....|....:.|...|  |:      .|.|.:|:     |...|
plant   134 T--NAAVTVKCRIGVDDHDSYNELCDFIHIVSSLSPTKHFIIHSRKALLSGLSPS-----DNRRI 191

  Fly   200 PAM------SQVRQSLQIPLIVNGNVESYRDACDMHEQTGAAGVMAARGLLANP 247
            |.:      :.:|....:...:||.:.|..:| |...::||.|||..|.:..||
plant   192 PPLKYEFFFALLRDFPDLKFTINGGINSVVEA-DAALRSGAHGVMLGRAVYYNP 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10495NP_609939.1 DUS_like_FMN 26..251 CDD:239200 56/241 (23%)
Dus 28..321 CDD:279540 56/239 (23%)
AT5G47970NP_001078731.1 TIM_phosphate_binding 1..312 CDD:304361 59/250 (24%)
Dus 13..337 CDD:279540 56/241 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1345916at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.