DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10495 and Dus4l

DIOPT Version :8

Sequence 1:NP_609939.1 Gene:CG10495 / 35179 FlyBaseID:FBgn0032750 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_082278.1 Gene:Dus4l / 71916 MGIID:1919166 Length:324 Species:Mus musculus

Alignment Length:320 Identity:141/320 - (44%)
Similarity:197/320 - (61%) Gaps:14/320 - (4%)


  Fly     6 QRPHHDIAAMFAEAQSDFVRVSAPMVRYSKLEFRRLVRLNGVQLAFTPMMISDSINNSEKARQNE 70
            |....|...||...|  .|:|.|||||||||.||.|||.....|.:|||:|:.....|.|||.:|
Mouse    12 QERKKDPIEMFHSGQ--LVKVCAPMVRYSKLAFRTLVRKYSCDLCYTPMIIAADFVRSIKARDSE 74

  Fly    71 FSTGADDQPLIAQFAAKDPTEFVTSAQLIYPYVDGIDLNCGCPQSWAMAKGYGCGMLRQPELVHQ 135
            |:|...|.|||.||||.|......:|.|:.||.:|||:||||||.||||.|||..::.:|||||.
Mouse    75 FTTNQGDCPLIVQFAANDARLLSDAALLVCPYANGIDINCGCPQRWAMADGYGACLINKPELVHD 139

  Fly   136 VVQEVRRTLPGD-FSVSVKMRLLGGEESLQRTIDLARQLESAGVTFLTLHGRTPAQKHSKDTLDI 199
            :|::||..:... ||||:|:|:   .:.|.|||||.|:.|:.||:::|:||||..::|.....| 
Mouse   140 MVRQVRNRVESPRFSVSIKIRI---HDDLARTIDLCRKAEATGVSWITVHGRTVEERHQPVHYD- 200

  Fly   200 PAMSQVRQSLQIPLIVNGNVESYRDACDMHEQTGAAGVMAARGLLANPALFNSNYPDGKTTPLSC 264
             |:..:::::.||::.||::.|.::|.::.:.||..|||.|||||.|||:| :.|.:   |||.|
Mouse   201 -AIKMIKENVSIPIVANGDIRSLKEAENVWQMTGTDGVMVARGLLTNPAMF-AGYEE---TPLKC 260

  Fly   265 VQQWLDIASAAGDNLLFQCFHHHLTFMYSAQMKRDLRVQFNSLGSKEQVVDFLKEHYNLE 324
            :..|:||:...|..  |.|||.||.:|......|..:..||:|.|...|:|:|.:||..|
Mouse   261 IWDWVDISLELGTP--FMCFHQHLMYMMEKITSRQEKRVFNALSSTSAVLDYLTDHYGDE 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10495NP_609939.1 DUS_like_FMN 26..251 CDD:239200 107/225 (48%)
Dus 28..321 CDD:279540 131/293 (45%)
Dus4lNP_082278.1 DUS_like_FMN 28..257 CDD:239200 110/237 (46%)
DusA 32..311 CDD:223120 130/289 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C212366767
eggNOG 1 0.900 E1_COG0042
Hieranoid 1 1.000
Homologene 1 1.000 H6535
Inparanoid 1 1.050 261 1.000 Inparanoid score I3070
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D549777at33208
OrthoFinder 1 1.000 FOG0004195
OrthoInspector 1 1.000 T1084327
orthoMCL 1 0.900 OOG5_129532
Panther 1 1.100 LDO PTHR11082
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R357
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.