DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10495 and DUS2

DIOPT Version :8

Sequence 1:NP_609939.1 Gene:CG10495 / 35179 FlyBaseID:FBgn0032750 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001258691.1 Gene:DUS2 / 54920 HGNCID:26014 Length:493 Species:Homo sapiens

Alignment Length:376 Identity:88/377 (23%)
Similarity:151/377 (40%) Gaps:77/377 (20%)


  Fly    26 VSAPMVRYSKLEFRRLVRLNGVQLAFTPMMISDSINNSEKARQNEFST----GADDQ-------- 78
            :.|||||...|..|.|....|..:.:...:|...:...::......||    ..||:        
Human    15 ILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMIQCKRVVNEVLSTVDFVAPDDRVVFRTCER 79

  Fly    79 ---PLIAQFAAKDPTEFVTSAQLIYPYVDGIDLNCGCPQSWAMAKGYGCGMLRQPELVHQV---- 136
               .::.|....|....:..|:|:...|.|||:|.|||:.::...|.|..:|..|:.:.::    
Human    80 EQNRVVFQMGTSDAERALAVARLVENDVAGIDVNMGCPKQYSTKGGMGAALLSDPDKIEKILSTL 144

  Fly   137 VQEVRRTLPGDFSVSVKMRLLGGEESLQRTIDLARQLESAGVTFLTLHGRTPAQKHSKDTLDIPA 201
            |:..||      .|:.|:|:|   .||:.|:.|.:::|..|:..:.:||| ..::..:..:....
Human   145 VKGTRR------PVTCKIRIL---PSLEDTLSLVKRIERTGIAAIAVHGR-KREERPQHPVSCEV 199

  Fly   202 MSQVRQSLQIPLIVNG----NVESYRDACDMHEQTGAAGVMAARGLLANPALFNSNYPDGKTTPL 262
            :..:..:|.||:|.||    :::.|.|..|..:.|.|:.||.||..:.||::|   ..:| ..||
Human   200 IKAIADTLSIPVIANGGSHDHIQQYSDIEDFRQATAASSVMVARAAMWNPSIF---LKEG-LRPL 260

  Fly   263 SCVQQWLDIASAAGDN-------LLFQCFHHHL-----TFMYSAQMKRDLRVQFNSLGSKEQVVD 315
            ..|.|.....:...||       .|.|.....|     ..:::||..|::...| .||:      
Human   261 EEVMQKYIRYAVQYDNHYTNTKYCLCQMLREQLESPQGRLLHAAQSSREICEAF-GLGA------ 318

  Fly   316 FLKEHYNLEYSEVDPPSADYTDCTYTHFTPPKHARHIAAESDEQAWSSKSD 366
                .|.....|:|...|                 .::|::.||......|
Human   319 ----FYEETTQELDAQQA-----------------RLSAKTSEQTGEPAED 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10495NP_609939.1 DUS_like_FMN 26..251 CDD:239200 64/248 (26%)
Dus 28..321 CDD:279540 80/328 (24%)
DUS2NP_001258691.1 Catalytic domain. {ECO:0000269|PubMed:26429968} 1..333 84/360 (23%)
DUS_like_FMN 13..252 CDD:239200 63/247 (26%)
Interaction with tRNA. {ECO:0000269|PubMed:30605527} 367..371
DSRM 369..433 CDD:238007
Interaction with tRNA. {ECO:0000269|PubMed:30605527} 420..424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.