DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10495 and dus3l

DIOPT Version :8

Sequence 1:NP_609939.1 Gene:CG10495 / 35179 FlyBaseID:FBgn0032750 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_012819922.1 Gene:dus3l / 394959 XenbaseID:XB-GENE-943237 Length:645 Species:Xenopus tropicalis

Alignment Length:329 Identity:87/330 (26%)
Similarity:140/330 (42%) Gaps:35/330 (11%)


  Fly    28 APMVRYSKLEFRRLVRLNGVQLAFTPMMISDSINNSEKARQNEFSTGADDQPLIAQFAAKDPTEF 92
            ||:.....|.||||.:..|..:....|.:..::...:.:..........:.....|.....|...
 Frog   305 APLTTCGNLPFRRLCKRFGADITCGEMAMCTNLLQGQPSEWALLKRHHSEDIFGVQLEGAFPDTM 369

  Fly    93 VTSAQLIYPY--VDGIDLNCGCPQSWAMAKGYGCGMLRQPELVHQVVQEVRRTLPGDFSVSVKMR 155
            ...|:|:...  ||.:|:|.|||......||.|||::.:.....|:|:.:...|  |..::||:|
 Frog   370 TKCAELLNRTIDVDFVDINVGCPIDLVYKKGGGCGLMNRTNKFEQIVKGMNSVL--DVPLTVKIR 432

  Fly   156 LLGGEESLQRTIDLARQLESAGVTFLTLHGRTPAQKHSK--DTLDIPAMSQVRQSLQIPLIVNGN 218
             .|.:|.:.....|...|...||:.:|||||:..|:::|  |...|...:.:...|  ||..||:
 Frog   433 -TGVQEKINIAHKLIPNLRDWGVSLVTLHGRSREQRYTKLADWEYIAQCADIASPL--PLFGNGD 494

  Fly   219 VESYRDACDMHEQTGAAGVMAARGLLANPALFNSNYPDGKTTPLSCVQQWLDIASAAGDNLLFQC 283
            :.||.|| :...|||.:|:|.|||.|..|.||         |.:...:.| ||:|....::|...
 Frog   495 IISYEDA-NRALQTGVSGIMLARGALLKPWLF---------TEIKEQRHW-DISSTERFDILKDF 548

  Fly   284 FHHHLTFMYS----AQMKRDLRVQFNS-------LGSKEQVVDFLKE----HYNLEYSEVDPPSA 333
            .::.|....|    .:..|...:::.|       :|..|.|...:.|    :...:|.|....|.
 Frog   549 TNYGLEHWGSDCQGVEKTRRFMLEWLSFLCRYIPIGLLEHVPQKINERPPYYMGRDYMETLMASQ 613

  Fly   334 DYTD 337
            :.||
 Frog   614 NVTD 617

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10495NP_609939.1 DUS_like_FMN 26..251 CDD:239200 68/227 (30%)
Dus 28..321 CDD:279540 82/312 (26%)
dus3lXP_012819922.1 DusA 296..571 CDD:223120 77/282 (27%)
DUS_like_FMN 301..533 CDD:239200 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.