DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10495 and dus3l

DIOPT Version :9

Sequence 1:NP_609939.1 Gene:CG10495 / 35179 FlyBaseID:FBgn0032750 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_956968.1 Gene:dus3l / 393647 ZFINID:ZDB-GENE-040426-1260 Length:660 Species:Danio rerio


Alignment Length:275 Identity:76/275 - (27%)
Similarity:127/275 - (46%) Gaps:40/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 APMVRYSKLEFRRLVRLNGVQLAFTPMMISDSINNSEKARQNEFSTGADDQPLIAQFAAKD---- 88
            ||:.....|.|||:.:..|..:....|.:..::...:          |.:..|:.:.|::|    
Zfish   320 APLTTCGNLPFRRVCKRFGADITCGEMAMCTNLLQGQ----------ASEWALLKRHASEDLFGV 374

  Fly    89 ------PTEFVTSAQLIYPY--VDGIDLNCGCPQSWAMAKGYGCGMLRQPELVHQVVQEVRRTLP 145
                  |......|:|:...  ||.:|:|.|||......||.|||::.:.....|:|:.:...| 
Zfish   375 QLEGCFPDTMTRCAELLNQNIDVDFVDINSGCPIDLVYKKGGGCGLMTRTSKFEQIVRGMNSVL- 438

  Fly   146 GDFSVSVKMRLLGGEESLQRTIDLARQLESAGVTFLTLHGRTPAQKHSK--DTLDIPAMSQVRQS 208
             |..::||:| .|.:::......|..:::..||:.:|||||:..|:::|  |...|...:|:  :
Zfish   439 -DVPLTVKIR-TGVQQNSNIAHKLIPEMKKWGVSLITLHGRSREQRYTKLADWDYINTCAQL--A 499

  Fly   209 LQIPLIVNGNVESYRDACDMHEQTGAAGVMAARGLLANPALFNSNYPDGKTTPLSCVQQWLDIAS 273
            ..:||..||::.||.||....| ||.:|:|.|||.|..|.||         |.:...:.| ||:|
Zfish   500 APVPLFGNGDILSYEDAMKARE-TGVSGIMVARGALIKPWLF---------TEIKESRHW-DISS 553

  Fly   274 AAGDNLLFQCFHHHL 288
            ....::|....|..|
Zfish   554 TERLDILRDFTHFGL 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10495NP_609939.1 DUS_like_FMN 26..251 CDD:239200 67/236 (28%)
Dus 28..321 CDD:279540 76/275 (28%)
dus3lNP_956968.1 Phage_Gp23 <212..281 CDD:287621
DusA 307..597 CDD:223120 76/275 (28%)
DUS_like_FMN 316..548 CDD:239200 69/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.