DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl37BC and Dynlrb2

DIOPT Version :9

Sequence 1:NP_609931.1 Gene:robl37BC / 35166 FlyBaseID:FBgn0028569 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_083573.1 Gene:Dynlrb2 / 75465 MGIID:1922715 Length:96 Species:Mus musculus


Alignment Length:90 Identity:29/90 - (32%)
Similarity:58/90 - (64%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VQMTFDRLVQLPGVTGAILIDGNGVPVRTNLPANVARIYADRMRPLVILARSMVQDLENGDELSY 70
            |:.|..|:....||.|.::::..|:|:||.|..:....||..:..|.:.|:|.|:|::..::|::
Mouse     4 VEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKAKSTVRDIDPQNDLTF 68

  Fly    71 VRLRTRRQETMVATENEHTIILIQD 95
            :|:|:::.|.|||.:.|:.:|:||:
Mouse    69 LRIRSKKHEIMVAPDKEYLLIVIQN 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl37BCNP_609931.1 Robl_LC7 7..95 CDD:281277 27/87 (31%)
Dynlrb2NP_083573.1 Robl_LC7 3..93 CDD:397386 28/88 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2020
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.820

Return to query results.
Submit another query.