DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: robl37BC and dynlrb2

Sequence 1:NP_609931.1 Gene:robl37BC FlyBaseID:FBgn0028569 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001016395.1 Gene:dynlrb2 XenbaseID:XB-GENE-491537 Length:96 Species:Xenopus tropicalis

Alignment Length:90 Identity:30/91 (33%)
Similarity:58/91 (64%) Gaps:0/91 (0%)


  Fly     6 VQMTFDRLVQLPGVTGAILIDGNGVPVRTNLPANVARIYADRMRPLVILARSMVQDLENGDELSY 70
            |:.|..|:....||.|.|:::..|:|:||.|..:....||..:..|.:.|:|.|:|::..::|::
 Frog     4 VEETLKRIQSHKGVIGTIVVNAEGIPIRTTLDNSTTVQYAGLLHQLSMKAKSTVRDIDPQNDLTF 68

  Fly    71 VRLRTRRQETMVATENEHTIILIQD 95
            :|:|:::.|.|||.:.|:.:|:||:
 Frog    69 LRIRSKKHEIMVAPDKEYLLIVIQN 93

Known Domains:


GeneSequenceDomainRegion External IDIdentity
robl37BCNP_609931.1 Robl_LC7 7..95 CDD:281277 29/88 (33%)
dynlrb2NP_001016395.1 Robl_LC7 5..93 CDD:281277 29/88 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.860

Return to query results.
Submit another query.