DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: robl37BC and CG16837

Sequence 1:NP_609931.1 Gene:robl37BC FlyBaseID:FBgn0028569 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_611916.1 Gene:CG16837 FlyBaseID:FBgn0035009 Length:130 Species:Drosophila melanogaster

Alignment Length:102 Identity:28/103 (27%)
Similarity:57/103 (55%) Gaps:7/103 (7%)


  Fly    11 DRLVQLPGVTGA---ILIDGNGVPVRTNLPANVARIYADRMRPLVILARSMVQDLENGDELSYVR 72
            |..|.|....||   :::|.:|||:|:........::...::||:.:||::|:||:..::::::|
  Fly    33 DAFVNLFAHRGARDIMILDSHGVPLRSTCSQRRTFVFVSNLKPLLFMARNVVRDLDPSNDITFMR 97

  Fly    73 LRTRRQETMVATENEHTIILIQDNRVLDESWRSSVAS 109
            :|:...|..:....:..:|::|..|.|    |||..|
  Fly    98 IRSNMGEIHMTLGTDFILIVVQKLRRL----RSSSTS 130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
robl37BCNP_609931.1 Robl_LC7 7..95 CDD:281277 22/87 (25%)
CG16837NP_611916.1 Robl_LC7 35..119 CDD:281277 20/84 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4115
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2020
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10779
RoundUp 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.