DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl37BC and CG16837

DIOPT Version :10

Sequence 1:NP_609931.1 Gene:robl37BC / 35166 FlyBaseID:FBgn0028569 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_611916.1 Gene:CG16837 / 37904 FlyBaseID:FBgn0035009 Length:130 Species:Drosophila melanogaster


Alignment Length:102 Identity:28/102 - (27%)
Similarity:57/102 - (55%) Gaps:7/102 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DRLVQLPGVTGA---ILIDGNGVPVRTNLPANVARIYADRMRPLVILARSMVQDLENGDELSYVR 72
            |..|.|....||   :::|.:|||:|:........::...::||:.:||::|:||:..::::::|
  Fly    33 DAFVNLFAHRGARDIMILDSHGVPLRSTCSQRRTFVFVSNLKPLLFMARNVVRDLDPSNDITFMR 97

  Fly    73 LRTRRQETMVATENEHTIILIQDNRVLDESWRSSVAS 109
            :|:...|..:....:..:|::|..|.|    |||..|
  Fly    98 IRSNMGEIHMTLGTDFILIVVQKLRRL----RSSSTS 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl37BCNP_609931.1 Robl_LC7 5..95 CDD:397386 21/86 (24%)
CG16837NP_611916.1 Robl_LC7 30..119 CDD:397386 21/85 (25%)

Return to query results.
Submit another query.