DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: robl37BC and Dynlrb1

Sequence 1:NP_609931.1 Gene:robl37BC FlyBaseID:FBgn0028569 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_571985.1 Gene:Dynlrb1 RGDID:619910 Length:96 Species:Rattus norvegicus

Alignment Length:90 Identity:27/91 (30%)
Similarity:58/91 (64%) Gaps:0/91 (0%)


  Fly     6 VQMTFDRLVQLPGVTGAILIDGNGVPVRTNLPANVARIYADRMRPLVILARSMVQDLENGDELSY 70
            |:.|..||....||.|.|:::..|:|:::.:.......||:.|...::.|||.|::::..::|::
  Rat     4 VEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTF 68

  Fly    71 VRLRTRRQETMVATENEHTIILIQD 95
            :|:|:::.|.|||.:.::.:|:||:
  Rat    69 LRIRSKKNEIMVAPDKDYFLIVIQN 93

Known Domains:


GeneSequenceDomainRegion External IDIdentity
robl37BCNP_609931.1 Robl_LC7 7..95 CDD:281277 26/88 (30%)
Dynlrb1NP_571985.1 Robl_LC7 4..91 CDD:214939 25/87 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10779
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.