DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15170 and CG34040

Sequence 1:NP_609927.1 Gene:CG15170 FlyBaseID:FBgn0032733 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001033963.1 Gene:CG34040 FlyBaseID:FBgn0054040 Length:281 Species:Drosophila melanogaster

Alignment Length:195 Identity:48/196 (24%)
Similarity:65/196 (33%) Gaps:51/196 (26%)


  Fly   331 KCYECDEGAGCNSKDFTRCYQCSTDQAGAGCANWESPGEIYIEECDEPAAPCVVVSFNNATTARG 395
            ||..|.:         ..|.:.|.|..               |:|.|....||.|.......|:|
  Fly    25 KCIYCRD---------INCQRSSYDAD---------------EQCSEKLDACVSVFKAGVIQAQG 65

  Fly   396 CQKS---DF--SCA---SANVASCRLCEGSFCNKGSFPEERLWCHQCRGVQD--CEEISRGQTAM 450
            |.:|   |:  .|.   ..|...|.:|....||  :...:|..|.||...:|  |.|.....||:
  Fly    66 CLESLEDDWREKCEDKDKGNEIDCEICVTERCN--NVAAKRTSCIQCNNTEDAQCAESPGLLTAV 128

  Fly   451 PCP-ARANEPEDQELACLEYFDINSKEIVRGCRSNPELYYECLLRSNHFDSCRTC---HSQACNN 511
            .|| ||:...     .|  |..:...::.|||........:||...|    |..|   ....||:
  Fly   129 QCPIARSGRS-----FC--YASLVGDDLKRGCSLTLSDQVKCLADPN----CHLCDPLEQPHCND 182

  Fly   512  511
              Fly   183  182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15170NP_609927.1 DUF753 35..166 CDD:283175
DUF753 278..416 CDD:283175 21/93 (23%)
DUF753 351..506 CDD:283175 42/169 (25%)
CG34040NP_001033963.1 DUF753 25..173 CDD:283175 46/185 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131028674
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21721
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.